File: blk04261.txt

text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"ordi","amt":"6000"}h!
FjDOUT:58703837E02B9CE7499CC852BDA67F6FB5DC0E2FC83596AFD9C4DE30524C6493
text/plain;charset=utf-8
6{"p":"brc-20","op":"transfer","tick":"ordi","amt":"6"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"transfer","tick":"ordi","amt":"6"}h!
Bj@=:BCH.BCH:qqnalmjvsunmf406ypq4kv59x8y7acqcuva89yp20w:0/1/1:ej:75
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"500000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"500000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"slor","amt":"15000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"satx","amt":"100000000000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"500000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"slor","amt":"999"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"SoIa","amt":"21000000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"500000"}h!
Lu<!DOCTYPE html><script 3143 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3132 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3141 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3089 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3101 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
K/content/7c490b489843a4e3cf9a74a6a5d2db18c04ea7ac55f8821d650a9bfd40eebf17i0h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841609"}h!
K/content/7c490b489843a4e3cf9a74a6a5d2db18c04ea7ac55f8821d650a9bfd40eebf17i0h!
K/content/7c490b489843a4e3cf9a74a6a5d2db18c04ea7ac55f8821d650a9bfd40eebf17i0h!
Lu<!DOCTYPE html><script 3098 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
,j*0xf3ea147d22fd4a69e1c12b8ff7a6567c52727ee7
text/plain;charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"sats","amt":"700999500"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"Aleo","amt":"1000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"53724251"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"chat","amt":"5000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"PUPS","amt":"50"}h!
,j*0x26b8ec9c2de079169ba587d6c2234f043b59933e
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"SHNT","amt":"1000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"sxio","amt":"14000"}h!
Lu<!DOCTYPE html><script 3090 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3040 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3120 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3112 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3068 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3085 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3067 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3075 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3087 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3126 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Bj@=:ETH.ETH:0x9410820F48e4AFDfe2f1ebFB3Bac76Bbb4ccDC61:0/1/0:td:70
Lu<!DOCTYPE html><script 3070 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
etitlewGenetic Spiral [GGGGGY]
<svg viewBox="0 0 186 186" xmlns="http://www.w3.org/2000/svg"><rect width="186" height="186" rx="31" fill="black"/><rect x="144" y="63.62" rx="4" width="37.3" height="8" transform="rotate(-135 147.04 63.62)" fill="#00E89F"/><rect x="139" y="80.89" rx="4" width="51.4" height="8" transform="rotate(-135 141.693 80.89)" fill="#00E89F"/><rect x="125" y="91.24" rx="4" width="41.8" height="8" transform="rotate(-135 129.418 91.24)" fill="#00E89F"/><circle cx="71" cy="92.994" r="4.01" fill="white"/><circle cx="111.6" cy="92M
.994" r="4.01" fill="white"/><circle cx="150.46" cy="23" r="4.01" fill="white"/><circle cx="32" cy="163" r="4.01" fill="white"/><circle cx="130" cy="23" r="4.01" fill="#00E89F"/><circle cx="52" cy="163" r="4.01" fill="#00E89F"/><rect x="50" y="94.75" rx="4" width="40.4" height="8" transform="rotate(45 53.03 94.75)" fill="#00E89F"/><rect x="37" y="105.10" rx="4" width="52.5" height="8" transform="rotate(45 40.76 105.10)" fill="#00E89F"/><rect x="32" y="122.37" rx="4" width="37.7" height="8" transform="rotate(45 35.4M
0 122.37)" fill="#FFD700"/><path fill-rule="evenodd" clip-rule="evenodd" d="M1 167H52V159H62C75.80 159 87 147.807 87 134V93H95V134C95 152.22 80.22 167 62 167Z M2 19H130V27H120C106.19 27 95 38.19 95 52V93H87V52C87 33.77 101.77 19 120 19Z" fill="#00E89F"/><path fill-rule="evenodd" clip-rule="evenodd" d="M3 89H71V97H61C47.19 97 36 108.19 36 122V163H28V122C28 103.77 42.77 89 61 89Z M4 96.99H111.45V88.99H121.45C135.26 88.99 146.45 77.80 146.45 63.99V22.99H154.45V63.99C154.45 82.22 139.68 96.99 121.45 96.99Z" fill="white	"/></svg>h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"$DOG","amt":"1000000000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"PUPS","amt":"40"}h!
,j*0x97583924a0d61a03bc4a5d1adcad23942fa205b0
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"core","amt":"10000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"honk","amt":"6000000"}h!
text/plain;charset=utf-8
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
text/html;charset=utf-8
<script data-s="0x2015b67856889bae39e4aec235063d1d3235e5e708bd850d9468232fab79add4" src="/content/f80b93466a28c5efc703fab02beebbf4e32e1bc4f063ac27fedfd79ad982f2cei0"></script><body style="display: none"></body>
Lu<!DOCTYPE html><script 3082 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3018 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
""""""""""""""""""""""""""""""""S
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"rcsv","amt":"146000"}h!
Lu<!DOCTYPE html><script 3045 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3105 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3088 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3102 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3100 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3096 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3027 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
1f/MARA Pool (v031924)/p
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"MMSS","amt":"1309.714864"}h!
text/plain; charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"MMSS","amt":"89728.748"}h!
text/plain; charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"MMSS","amt":"114155"}h!
text/plain; charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"MMSS","amt":"8680"}h!
text/plain; charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"MMSS","amt":"1000"}h!
text/plain; charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"MMSS","amt":"26060"}h!
text/plain; charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"MMSS","amt":"4180"}h!
text/plain; charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"MMSS","amt":"6080"}h!
text/plain; charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"MMSS","amt":"940"}h!
text/plain; charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"MMSS","amt":"9135"}h!
text/plain; charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"MMSS","amt":"10000"}h!
text/plain; charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"MMSS","amt":"300"}h!
text/plain; charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"MMSS","amt":"63700"}h!
text/plain; charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"MMSS","amt":"7160"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"44444444444"}h!
text/plain;charset=utf-8
text/html;charset=utf-8
<iframe src="/content/fb162a46943e5d7d31d72ee2c8c850e66c1ca5d0d453068aa63883528285ed21i0?tokenID=7119" style="border:0" width=100% height=100%></iframe>
Lu<!DOCTYPE html><script 3034 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3076 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841610"}h!
Lu<!DOCTYPE html><script 3130 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3131 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/html;charset=utf-8
<html lang="en"><title>Island Mist - Genify.XYZ</title><style>body{background:#000;margin:0;overflow: hidden;display:flex;justify-content:center;align-items:center;}</style><style id="gcss"></style><body><script>var tokenHash="0x1cd4f19c58e48b0d02d7fa882db0ad5351b5af88507db8968ddc158f2a36a5b6",tokenData={hash:tokenHash},hseed=1714541208</script><script src="/content/c9f2fc439b96b5ea98db5fd93e04ea84623fe6d210c06d40f90f027033696b43i0"></script><script src="/content/4101ee42de35bc37872be466b4801c36ed08088d6df05b0a7cb3L
f38f5e6bff3fi0"></script><div id="cw"></div><script src="/content/48bc9d562ca57e7d85b0fa873437654d9eca1b1dbd8d5c852823c2256faf748bi0"></script>h!
text/html;charset=utf-8
<html lang="en"><title>Island Mist - Genify.XYZ</title><style>body{background:#000;margin:0;overflow: hidden;display:flex;justify-content:center;align-items:center;}</style><style id="gcss"></style><body><script>var tokenHash="0xe2dfe741899c1eac6fae50671cf6340e1285d7aac8850a000f6bbbb007b58dee",tokenData={hash:tokenHash},hseed=1714539938</script><script src="/content/c9f2fc439b96b5ea98db5fd93e04ea84623fe6d210c06d40f90f027033696b43i0"></script><script src="/content/4101ee42de35bc37872be466b4801c36ed08088d6df05b0a7cb3L
f38f5e6bff3fi0"></script><div id="cw"></div><script src="/content/48bc9d562ca57e7d85b0fa873437654d9eca1b1dbd8d5c852823c2256faf748bi0"></script>h!
Bj@=:BSC.BNB:0x75377AAFb8a2eacca292FF7943c5AA07FfE02f6E:0/1/0:td:70
Bj@=:BSC.BNB:0x33caf11Ab30cc518D5fA372df00fF706500207C3:0/1/0:td:70
text/plain;charset=utf-8
    "op":"dmt-mint",
    "assembly":"a1ac940db8b952b1b7b705b24b3bd3adfa53f1cacad2e05a89332ab35c570be7i0",
    "tick": "natjaguar",
CjA=:LTC.LTC:ltc1q4xjfrtl9wdknzr44ajs4ee55mj7v4yq39n4h2h:0/1/0:td:70
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"zbit","amt":"584"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"2100","amt":"14700"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"tshx","amt":"6167"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"50000000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"24000000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"trac","amt":"250"}h!
text/plain;charset=utf-8
F{"p":"brc-20","op":"transfer","tick":"rats","amt":"43826952.20012798"}h!
uiCCPkCGColorSpaceDisplayP3
iTXtXML:com.adobe.xmp
<x:xmpmeta xmlns:x="adobe:ns:meta/" x:xmptk="XMP Core 6.0.0">
   <rdf:RDF xmlns:rdf="http://www.w3.org/1999/02/22-rdf-syntax-ns#">
      <rdf:Description rdf:about=""
            xmlns:dc="http://purl.org/dc/elements/1.1/"
            xmlns:tiff="http://ns.adobe.com/tiff/1.0/"
            xmlns:Iptc4xmpExt="http://iptc.org/std/Iptc4xmpExt/2008-02-29/">
            <rdf:Alt>
               <rdf:li xml:lang="x-defaultM
">Immagine inserita</rdf:li>
            </rdf:Alt>
         </dc:title>
         <tiff:YResolution>132</tiff:YResolution>
         <tiff:XResolution>132</tiff:XResolution>
         <tiff:PhotometricInterpretation>2</tiff:PhotometricInterpretation>
         <tiff:ResolutionUnit>2</tiff:ResolutionUnit>
         <Iptc4xmpExt:ArtworkTitle>Immagine inserita</Iptc4xmpExt:ArtworkTitle>
      </rdf:Description>
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"16ec362c368f056294351ca215bef985a3f143c8d89d26f42a7dd068dc60e5a3","iid":"100Ordinals","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":50,"minter":"bc1phr9zta846wugl2hrlfa74lf35j7w4wn8p025gvsauyedz8ajpv5sz28rpt","sig":"GyeqBMHn6UlpC4EMoRskoa4ht0422QdijfFBk8yDXBRXeerTqq3SFTAFiou75OEimyecZjfY8LxwArP/kMkQ+hI="}hA
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"47000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"core","amt":"10000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"rats","amt":"183334"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"SHIB","amt":"50000000000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"SHIB","amt":"50000000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"2100","amt":"14700"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"core","amt":"10000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"SHIB","amt":"50000000000"}h!
Bj@=:ETH.ETH:0xb71a73b5664467ca7310251d4f41bC0F6504bf18:0/1/0:td:70
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3038 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3035 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3084 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
:[{"p":"brc-20","op":"transfer","tick":"cpos","amt":"720"}]h!
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3025 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3069 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
1f/MARA Pool (v031924)/
CjA=:ETH.USDT:0x0f47023638f4c0114f3a26b4468c84879a1fa1ca:0/1/0:dx:10
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"sats","amt":"163234066670"}h!
Lu<!DOCTYPE html><script 3083 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
FjDOUT:74B8BC3E3761DB3958E7C06F8C1A09CD827674EBD88A6771B4C65B8CA3FA79F4
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"TRIO","amt":"200"}h!
Lu<!DOCTYPE html><script 3161 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"core","amt":"30000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"5990"}h!
text/plain;charset=utf-8
C{"p":"brc-20","op":"transfer","tick":"sats","amt":"91973429119.71"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"zbit","amt":"500"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"PGID","amt":"3000"}h!
Automatic cold wallet send
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
text/html;charset=utf-8
    <meta charset="UTF-8">
    <!-- BlockPepes-Runes-148 -->
            margin: 0;
            padding: 0;
            height: 100%;
            width: 100%;
        #canvas-frame {
            display: flex;
            justify-content: center;
            align-items: center;
            height: 100%;
            width: 100%;
            background: #ff5100;
        #svg-container {
            max-width: 100%M
            max-height: 100%;
    <div id="canvas-frame">
        <div id="svg-container">
            <script defer>
                const imageUrls = ["/content/55a2bc8fdcb8bb8d0bff347ed3ba8ae888b84b5ccda1fd68fb7d62b5084cac87i0",
                    "/content/3580be488cf0792e1292e82ed07072a4af1a5fff5375f4fc2f4658d1fb0b3da2i0",
                    "/content/3a1d03c25818ed2a6945d0ebbb3bc9da4f61097b1f7f222000f4c489ef96e709i0"];
                const svg = document.createElemeM
ntNS("http://www.w3.org/2000/svg", "svg");
                svg.setAttribute("viewBox", "0 0 250 250");
                svg.style.width = "100%";
                svg.style.height = "100%";
                imageUrls.forEach((url) => {
                    const img = document.createElementNS("http://www.w3.org/2000/svg", "image");
                    img.setAttribute("href", url);
                    img.setAttribute("width", "245");
                    img.setAttribute("height", "245");
                    img.style.M
imageRendering = "pixelated";
                    svg.appendChild(img);
                document.getElementById("svg-container").appendChild(svg);
                let currentBlock = null;
                const fetchBlockHeight = () => {
                    fetch("/r/blockheight")
                        .then(res => res.text())
                        .then(data => {
                            const newBlock = parseInt(data, 10);
                            if (newBlock !== currentBlock) {
                             currentBlock = newBlock;
                                startEffect(10000);
                            }
                        })
                        .finally(() => setTimeout(fetchBlockHeight, 5000));
                const startEffect = (duration) => {
                    let hue = 50, brightness = 85, direction = 20;
                    const rotate = setInterval(() => {
                        hue = (hue + 1) % 360;
                        brightness += diM
                        if (brightness >= 200 || brightness <= 50) direction *= -1;
                        updateFilter(hue, brightness);
                    }, 50);
                    setTimeout(() => {
                        clearInterval(rotate);
                        updateFilter(0, 100);
                    }, duration);
                const updateFilter = (hue, brightness) => {
                    const imgs = document.getElementsByTagName("image");
                    if (L
imgs.length > 0) imgs[0].style.filter = `brightness(${brightness}%) hue-rotate(${hue}deg) saturate(100%)`;
                fetchBlockHeight(); // Start the fetch process
            </script>
text/html;charset=utf-8
    <meta charset="UTF-8">
    <!-- BlockPepes-Runes-149 -->
            margin: 0;
            padding: 0;
            height: 100%;
            width: 100%;
        #canvas-frame {
            display: flex;
            justify-content: center;
            align-items: center;
            height: 100%;
            width: 100%;
            background: #ff5100;
        #svg-container {
            max-width: 100%M
            max-height: 100%;
    <div id="canvas-frame">
        <div id="svg-container">
            <script defer>
                const imageUrls = ["/content/ebb7ceb79c597a09e1df8b35a408d1d9322335e5d0e8fbaae06cd904304fb28ei0",
                    "/content/83a4b7d47db24aae406b578f1c7d5ab1f8d2b928fbfd88be359284ad2479b06bi0",
                    "/content/2aee175b35f43ab17e9d2666980e2e6a0ab9aa2e60be49887024f88fe37f6a1bi0"];
                const svg = document.createElemeM
ntNS("http://www.w3.org/2000/svg", "svg");
                svg.setAttribute("viewBox", "0 0 250 250");
                svg.style.width = "100%";
                svg.style.height = "100%";
                imageUrls.forEach((url) => {
                    const img = document.createElementNS("http://www.w3.org/2000/svg", "image");
                    img.setAttribute("href", url);
                    img.setAttribute("width", "245");
                    img.setAttribute("height", "245");
                    img.style.M
imageRendering = "pixelated";
                    svg.appendChild(img);
                document.getElementById("svg-container").appendChild(svg);
                let currentBlock = null;
                const fetchBlockHeight = () => {
                    fetch("/r/blockheight")
                        .then(res => res.text())
                        .then(data => {
                            const newBlock = parseInt(data, 10);
                            if (newBlock !== currentBlock) {
                             currentBlock = newBlock;
                                startEffect(10000);
                            }
                        })
                        .finally(() => setTimeout(fetchBlockHeight, 5000));
                const startEffect = (duration) => {
                    let hue = 50, brightness = 85, direction = 20;
                    const rotate = setInterval(() => {
                        hue = (hue + 1) % 360;
                        brightness += diM
                        if (brightness >= 200 || brightness <= 50) direction *= -1;
                        updateFilter(hue, brightness);
                    }, 50);
                    setTimeout(() => {
                        clearInterval(rotate);
                        updateFilter(0, 100);
                    }, duration);
                const updateFilter = (hue, brightness) => {
                    const imgs = document.getElementsByTagName("image");
                    if (L
imgs.length > 0) imgs[0].style.filter = `brightness(${brightness}%) hue-rotate(${hue}deg) saturate(100%)`;
                fetchBlockHeight(); // Start the fetch process
            </script>
text/html;charset=utf-8
    <meta charset="UTF-8">
    <!-- BlockPepes-Runes-147 -->
            margin: 0;
            padding: 0;
            height: 100%;
            width: 100%;
        #canvas-frame {
            display: flex;
            justify-content: center;
            align-items: center;
            height: 100%;
            width: 100%;
            background: #ff5100;
        #svg-container {
            max-width: 100%M
            max-height: 100%;
    <div id="canvas-frame">
        <div id="svg-container">
            <script defer>
                const imageUrls = ["/content/ebb7ceb79c597a09e1df8b35a408d1d9322335e5d0e8fbaae06cd904304fb28ei0",
                    "/content/bb58338ba847ff7d98c8f2f126836571009491988e651d762cf02cdeac5dfac9i0",
                    "/content/28795d33fa6c32ea550ad57636c877f01de1f64061c7bce864f003ac8f203294i0"];
                const svg = document.createElemeM
ntNS("http://www.w3.org/2000/svg", "svg");
                svg.setAttribute("viewBox", "0 0 250 250");
                svg.style.width = "100%";
                svg.style.height = "100%";
                imageUrls.forEach((url) => {
                    const img = document.createElementNS("http://www.w3.org/2000/svg", "image");
                    img.setAttribute("href", url);
                    img.setAttribute("width", "245");
                    img.setAttribute("height", "245");
                    img.style.M
imageRendering = "pixelated";
                    svg.appendChild(img);
                document.getElementById("svg-container").appendChild(svg);
                let currentBlock = null;
                const fetchBlockHeight = () => {
                    fetch("/r/blockheight")
                        .then(res => res.text())
                        .then(data => {
                            const newBlock = parseInt(data, 10);
                            if (newBlock !== currentBlock) {
                             currentBlock = newBlock;
                                startEffect(10000);
                            }
                        })
                        .finally(() => setTimeout(fetchBlockHeight, 5000));
                const startEffect = (duration) => {
                    let hue = 50, brightness = 85, direction = 20;
                    const rotate = setInterval(() => {
                        hue = (hue + 1) % 360;
                        brightness += diM
                        if (brightness >= 200 || brightness <= 50) direction *= -1;
                        updateFilter(hue, brightness);
                    }, 50);
                    setTimeout(() => {
                        clearInterval(rotate);
                        updateFilter(0, 100);
                    }, duration);
                const updateFilter = (hue, brightness) => {
                    const imgs = document.getElementsByTagName("image");
                    if (L
imgs.length > 0) imgs[0].style.filter = `brightness(${brightness}%) hue-rotate(${hue}deg) saturate(100%)`;
                fetchBlockHeight(); // Start the fetch process
            </script>
text/html;charset=utf-8
    <meta charset="UTF-8">
    <!-- BlockPepes-Runes-150 -->
            margin: 0;
            padding: 0;
            height: 100%;
            width: 100%;
        #canvas-frame {
            display: flex;
            justify-content: center;
            align-items: center;
            height: 100%;
            width: 100%;
            background: #ff5100;
        #svg-container {
            max-width: 100%M
            max-height: 100%;
    <div id="canvas-frame">
        <div id="svg-container">
            <script defer>
                const imageUrls = ["/content/b02be46623c3801f3d97ee1941c7484877a5b2bb2bc2e7bd288463e8af61ad0ei0"];
                const svg = document.createElementNS("http://www.w3.org/2000/svg", "svg");
                svg.setAttribute("viewBox", "0 0 250 250");
                svg.style.width = "100%";
                svg.style.height = "100%";
      imageUrls.forEach((url) => {
                    const img = document.createElementNS("http://www.w3.org/2000/svg", "image");
                    img.setAttribute("href", url);
                    img.setAttribute("width", "245");
                    img.setAttribute("height", "245");
                    img.style.imageRendering = "pixelated";
                    svg.appendChild(img);
                document.getElementById("svg-container").appendChild(svg);
                let currentBloM
                const fetchBlockHeight = () => {
                    fetch("/r/blockheight")
                        .then(res => res.text())
                        .then(data => {
                            const newBlock = parseInt(data, 10);
                            if (newBlock !== currentBlock) {
                                currentBlock = newBlock;
                                startEffect(10000);
                            }
                        })
                        .finally(()M
 => setTimeout(fetchBlockHeight, 5000));
                const startEffect = (duration) => {
                    let hue = 50, brightness = 85, direction = 20;
                    const rotate = setInterval(() => {
                        hue = (hue + 1) % 360;
                        brightness += direction;
                        if (brightness >= 200 || brightness <= 50) direction *= -1;
                        updateFilter(hue, brightness);
                    }, 50);
                    sM
                        clearInterval(rotate);
                        updateFilter(0, 100);
                    }, duration);
                const updateFilter = (hue, brightness) => {
                    const imgs = document.getElementsByTagName("image");
                    if (imgs.length > 0) imgs[0].style.filter = `brightness(${brightness}%) hue-rotate(${hue}deg) saturate(100%)`;
                fetchBlockHeight(); // Start the fetch process
        8    </script>
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"OFAN","amt":"8885"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"ordi","amt":"10.13"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"Pi-X","amt":"250000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"50000000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"50000000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"50000000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"100000000000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"50000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"4000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"19MM","amt":"1000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"meow","amt":"25000"}h!
FjDOUT:7AD3DB5482139B0DB5511623B4EA06490BB533C1E2E99B874418694AD2A74047
FjDOUT:1A2017DDFF55FDB717382970E6F309039C01AE2522680DBFA369007B203D7DFC
text/html;charset=utf-8
    <meta charset="UTF-8">
    <!-- BlockPepes-Runes-146 -->
            margin: 0;
            padding: 0;
            height: 100%;
            width: 100%;
        #canvas-frame {
            display: flex;
            justify-content: center;
            align-items: center;
            height: 100%;
            width: 100%;
            background: #ff5100;
        #svg-container {
            max-width: 100%M
            max-height: 100%;
    <div id="canvas-frame">
        <div id="svg-container">
            <script defer>
                const imageUrls = ["/content/55a2bc8fdcb8bb8d0bff347ed3ba8ae888b84b5ccda1fd68fb7d62b5084cac87i0",
                    "/content/6fde47a5f7112469739f6c35d189079bab35e11708c5b81601497e01b545a6f4i0",
                    "/content/3a1d03c25818ed2a6945d0ebbb3bc9da4f61097b1f7f222000f4c489ef96e709i0"];
                const svg = document.createElemeM
ntNS("http://www.w3.org/2000/svg", "svg");
                svg.setAttribute("viewBox", "0 0 250 250");
                svg.style.width = "100%";
                svg.style.height = "100%";
                imageUrls.forEach((url) => {
                    const img = document.createElementNS("http://www.w3.org/2000/svg", "image");
                    img.setAttribute("href", url);
                    img.setAttribute("width", "245");
                    img.setAttribute("height", "245");
                    img.style.M
imageRendering = "pixelated";
                    svg.appendChild(img);
                document.getElementById("svg-container").appendChild(svg);
                let currentBlock = null;
                const fetchBlockHeight = () => {
                    fetch("/r/blockheight")
                        .then(res => res.text())
                        .then(data => {
                            const newBlock = parseInt(data, 10);
                            if (newBlock !== currentBlock) {
                             currentBlock = newBlock;
                                startEffect(10000);
                            }
                        })
                        .finally(() => setTimeout(fetchBlockHeight, 5000));
                const startEffect = (duration) => {
                    let hue = 50, brightness = 85, direction = 20;
                    const rotate = setInterval(() => {
                        hue = (hue + 1) % 360;
                        brightness += diM
                        if (brightness >= 200 || brightness <= 50) direction *= -1;
                        updateFilter(hue, brightness);
                    }, 50);
                    setTimeout(() => {
                        clearInterval(rotate);
                        updateFilter(0, 100);
                    }, duration);
                const updateFilter = (hue, brightness) => {
                    const imgs = document.getElementsByTagName("image");
                    if (L
imgs.length > 0) imgs[0].style.filter = `brightness(${brightness}%) hue-rotate(${hue}deg) saturate(100%)`;
                fetchBlockHeight(); // Start the fetch process
            </script>
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"MMSS","amt":"20000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"ordi","amt":"19900"}h!
FjDOUT:8EC67AAB0B53182E052629AE1292A4186B376B3CC5B9B035FF3327AAB2151066
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
text/html;charset=utf-8
    <meta charset="UTF-8">
    <!-- BlockPepes-Runes-144 -->
            margin: 0;
            padding: 0;
            height: 100%;
            width: 100%;
        #canvas-frame {
            display: flex;
            justify-content: center;
            align-items: center;
            height: 100%;
            width: 100%;
            background: #ff5100;
        #svg-container {
            max-width: 100%M
            max-height: 100%;
    <div id="canvas-frame">
        <div id="svg-container">
            <script defer>
                const imageUrls = ["/content/ebb7ceb79c597a09e1df8b35a408d1d9322335e5d0e8fbaae06cd904304fb28ei0",
                    "/content/38f050da615e53298ba80432ca8de318880e713379d10a7c572755abb114156ai0",
                    "/content/28795d33fa6c32ea550ad57636c877f01de1f64061c7bce864f003ac8f203294i0"];
                const svg = document.createElemeM
ntNS("http://www.w3.org/2000/svg", "svg");
                svg.setAttribute("viewBox", "0 0 250 250");
                svg.style.width = "100%";
                svg.style.height = "100%";
                imageUrls.forEach((url) => {
                    const img = document.createElementNS("http://www.w3.org/2000/svg", "image");
                    img.setAttribute("href", url);
                    img.setAttribute("width", "245");
                    img.setAttribute("height", "245");
                    img.style.M
imageRendering = "pixelated";
                    svg.appendChild(img);
                document.getElementById("svg-container").appendChild(svg);
                let currentBlock = null;
                const fetchBlockHeight = () => {
                    fetch("/r/blockheight")
                        .then(res => res.text())
                        .then(data => {
                            const newBlock = parseInt(data, 10);
                            if (newBlock !== currentBlock) {
                             currentBlock = newBlock;
                                startEffect(10000);
                            }
                        })
                        .finally(() => setTimeout(fetchBlockHeight, 5000));
                const startEffect = (duration) => {
                    let hue = 50, brightness = 85, direction = 20;
                    const rotate = setInterval(() => {
                        hue = (hue + 1) % 360;
                        brightness += diM
                        if (brightness >= 200 || brightness <= 50) direction *= -1;
                        updateFilter(hue, brightness);
                    }, 50);
                    setTimeout(() => {
                        clearInterval(rotate);
                        updateFilter(0, 100);
                    }, duration);
                const updateFilter = (hue, brightness) => {
                    const imgs = document.getElementsByTagName("image");
                    if (L
imgs.length > 0) imgs[0].style.filter = `brightness(${brightness}%) hue-rotate(${hue}deg) saturate(100%)`;
                fetchBlockHeight(); // Start the fetch process
            </script>
text/html;charset=utf-8
    <meta charset="UTF-8">
    <!-- BlockPepes-Runes-142 -->
            margin: 0;
            padding: 0;
            height: 100%;
            width: 100%;
        #canvas-frame {
            display: flex;
            justify-content: center;
            align-items: center;
            height: 100%;
            width: 100%;
            background: #ff5100;
        #svg-container {
            max-width: 100%M
            max-height: 100%;
    <div id="canvas-frame">
        <div id="svg-container">
            <script defer>
                const imageUrls = ["/content/ebb7ceb79c597a09e1df8b35a408d1d9322335e5d0e8fbaae06cd904304fb28ei0",
                    "/content/b2b4ff77517c62887dd5a95895bf3a7b38c0ee8483fe3d64c08b26d4b99fbc2fi0",
                    "/content/395d2c62a9dab5979955c9d9390d6f32e15c90bd6a4bae812ee5c8fa2a9abd98i0"];
                const svg = document.createElemeM
ntNS("http://www.w3.org/2000/svg", "svg");
                svg.setAttribute("viewBox", "0 0 250 250");
                svg.style.width = "100%";
                svg.style.height = "100%";
                imageUrls.forEach((url) => {
                    const img = document.createElementNS("http://www.w3.org/2000/svg", "image");
                    img.setAttribute("href", url);
                    img.setAttribute("width", "245");
                    img.setAttribute("height", "245");
                    img.style.M
imageRendering = "pixelated";
                    svg.appendChild(img);
                document.getElementById("svg-container").appendChild(svg);
                let currentBlock = null;
                const fetchBlockHeight = () => {
                    fetch("/r/blockheight")
                        .then(res => res.text())
                        .then(data => {
                            const newBlock = parseInt(data, 10);
                            if (newBlock !== currentBlock) {
                             currentBlock = newBlock;
                                startEffect(10000);
                            }
                        })
                        .finally(() => setTimeout(fetchBlockHeight, 5000));
                const startEffect = (duration) => {
                    let hue = 50, brightness = 85, direction = 20;
                    const rotate = setInterval(() => {
                        hue = (hue + 1) % 360;
                        brightness += diM
                        if (brightness >= 200 || brightness <= 50) direction *= -1;
                        updateFilter(hue, brightness);
                    }, 50);
                    setTimeout(() => {
                        clearInterval(rotate);
                        updateFilter(0, 100);
                    }, duration);
                const updateFilter = (hue, brightness) => {
                    const imgs = document.getElementsByTagName("image");
                    if (L
imgs.length > 0) imgs[0].style.filter = `brightness(${brightness}%) hue-rotate(${hue}deg) saturate(100%)`;
                fetchBlockHeight(); // Start the fetch process
            </script>
text/html;charset=utf-8
    <meta charset="UTF-8">
    <!-- BlockPepes-Runes-143 -->
            margin: 0;
            padding: 0;
            height: 100%;
            width: 100%;
        #canvas-frame {
            display: flex;
            justify-content: center;
            align-items: center;
            height: 100%;
            width: 100%;
            background: #ff5100;
        #svg-container {
            max-width: 100%M
            max-height: 100%;
    <div id="canvas-frame">
        <div id="svg-container">
            <script defer>
                const imageUrls = ["/content/ebb7ceb79c597a09e1df8b35a408d1d9322335e5d0e8fbaae06cd904304fb28ei0",
                    "/content/3580be488cf0792e1292e82ed07072a4af1a5fff5375f4fc2f4658d1fb0b3da2i0",
                    "/content/2aee175b35f43ab17e9d2666980e2e6a0ab9aa2e60be49887024f88fe37f6a1bi0"];
                const svg = document.createElemeM
ntNS("http://www.w3.org/2000/svg", "svg");
                svg.setAttribute("viewBox", "0 0 250 250");
                svg.style.width = "100%";
                svg.style.height = "100%";
                imageUrls.forEach((url) => {
                    const img = document.createElementNS("http://www.w3.org/2000/svg", "image");
                    img.setAttribute("href", url);
                    img.setAttribute("width", "245");
                    img.setAttribute("height", "245");
                    img.style.M
imageRendering = "pixelated";
                    svg.appendChild(img);
                document.getElementById("svg-container").appendChild(svg);
                let currentBlock = null;
                const fetchBlockHeight = () => {
                    fetch("/r/blockheight")
                        .then(res => res.text())
                        .then(data => {
                            const newBlock = parseInt(data, 10);
                            if (newBlock !== currentBlock) {
                             currentBlock = newBlock;
                                startEffect(10000);
                            }
                        })
                        .finally(() => setTimeout(fetchBlockHeight, 5000));
                const startEffect = (duration) => {
                    let hue = 50, brightness = 85, direction = 20;
                    const rotate = setInterval(() => {
                        hue = (hue + 1) % 360;
                        brightness += diM
                        if (brightness >= 200 || brightness <= 50) direction *= -1;
                        updateFilter(hue, brightness);
                    }, 50);
                    setTimeout(() => {
                        clearInterval(rotate);
                        updateFilter(0, 100);
                    }, duration);
                const updateFilter = (hue, brightness) => {
                    const imgs = document.getElementsByTagName("image");
                    if (L
imgs.length > 0) imgs[0].style.filter = `brightness(${brightness}%) hue-rotate(${hue}deg) saturate(100%)`;
                fetchBlockHeight(); // Start the fetch process
            </script>
text/html;charset=utf-8
    <meta charset="UTF-8">
    <!-- BlockPepes-Runes-141 -->
            margin: 0;
            padding: 0;
            height: 100%;
            width: 100%;
        #canvas-frame {
            display: flex;
            justify-content: center;
            align-items: center;
            height: 100%;
            width: 100%;
            background: #ff5100;
        #svg-container {
            max-width: 100%M
            max-height: 100%;
    <div id="canvas-frame">
        <div id="svg-container">
            <script defer>
                const imageUrls = ["/content/9c81c7b7b7e1dfd057111e4e10cbd4ee4b6c218f3abc166aed4f9e2fdbc1ba01i0",
                    "/content/782ef0ac80df91bb4736dbcb1124bd71a469c221f14748fc649771003349434ei0",
                    "/content/3a1d03c25818ed2a6945d0ebbb3bc9da4f61097b1f7f222000f4c489ef96e709i0"];
                const svg = document.createElemeM
ntNS("http://www.w3.org/2000/svg", "svg");
                svg.setAttribute("viewBox", "0 0 250 250");
                svg.style.width = "100%";
                svg.style.height = "100%";
                imageUrls.forEach((url) => {
                    const img = document.createElementNS("http://www.w3.org/2000/svg", "image");
                    img.setAttribute("href", url);
                    img.setAttribute("width", "245");
                    img.setAttribute("height", "245");
                    img.style.M
imageRendering = "pixelated";
                    svg.appendChild(img);
                document.getElementById("svg-container").appendChild(svg);
                let currentBlock = null;
                const fetchBlockHeight = () => {
                    fetch("/r/blockheight")
                        .then(res => res.text())
                        .then(data => {
                            const newBlock = parseInt(data, 10);
                            if (newBlock !== currentBlock) {
                             currentBlock = newBlock;
                                startEffect(10000);
                            }
                        })
                        .finally(() => setTimeout(fetchBlockHeight, 5000));
                const startEffect = (duration) => {
                    let hue = 50, brightness = 85, direction = 20;
                    const rotate = setInterval(() => {
                        hue = (hue + 1) % 360;
                        brightness += diM
                        if (brightness >= 200 || brightness <= 50) direction *= -1;
                        updateFilter(hue, brightness);
                    }, 50);
                    setTimeout(() => {
                        clearInterval(rotate);
                        updateFilter(0, 100);
                    }, duration);
                const updateFilter = (hue, brightness) => {
                    const imgs = document.getElementsByTagName("image");
                    if (L
imgs.length > 0) imgs[0].style.filter = `brightness(${brightness}%) hue-rotate(${hue}deg) saturate(100%)`;
                fetchBlockHeight(); // Start the fetch process
            </script>
text/html;charset=utf-8
    <meta charset="UTF-8">
    <!-- BlockPepes-Runes-145 -->
            margin: 0;
            padding: 0;
            height: 100%;
            width: 100%;
        #canvas-frame {
            display: flex;
            justify-content: center;
            align-items: center;
            height: 100%;
            width: 100%;
            background: #ff5100;
        #svg-container {
            max-width: 100%M
            max-height: 100%;
    <div id="canvas-frame">
        <div id="svg-container">
            <script defer>
                const imageUrls = ["/content/55a2bc8fdcb8bb8d0bff347ed3ba8ae888b84b5ccda1fd68fb7d62b5084cac87i0",
                    "/content/8c8181ea0f038a1d360fc7eb186680b31213064002d2cd7b2eb04460dc21bacfi0",
                    "/content/3a1d03c25818ed2a6945d0ebbb3bc9da4f61097b1f7f222000f4c489ef96e709i0"];
                const svg = document.createElemeM
ntNS("http://www.w3.org/2000/svg", "svg");
                svg.setAttribute("viewBox", "0 0 250 250");
                svg.style.width = "100%";
                svg.style.height = "100%";
                imageUrls.forEach((url) => {
                    const img = document.createElementNS("http://www.w3.org/2000/svg", "image");
                    img.setAttribute("href", url);
                    img.setAttribute("width", "245");
                    img.setAttribute("height", "245");
                    img.style.M
imageRendering = "pixelated";
                    svg.appendChild(img);
                document.getElementById("svg-container").appendChild(svg);
                let currentBlock = null;
                const fetchBlockHeight = () => {
                    fetch("/r/blockheight")
                        .then(res => res.text())
                        .then(data => {
                            const newBlock = parseInt(data, 10);
                            if (newBlock !== currentBlock) {
                             currentBlock = newBlock;
                                startEffect(10000);
                            }
                        })
                        .finally(() => setTimeout(fetchBlockHeight, 5000));
                const startEffect = (duration) => {
                    let hue = 50, brightness = 85, direction = 20;
                    const rotate = setInterval(() => {
                        hue = (hue + 1) % 360;
                        brightness += diM
                        if (brightness >= 200 || brightness <= 50) direction *= -1;
                        updateFilter(hue, brightness);
                    }, 50);
                    setTimeout(() => {
                        clearInterval(rotate);
                        updateFilter(0, 100);
                    }, duration);
                const updateFilter = (hue, brightness) => {
                    const imgs = document.getElementsByTagName("image");
                    if (L
imgs.length > 0) imgs[0].style.filter = `brightness(${brightness}%) hue-rotate(${hue}deg) saturate(100%)`;
                fetchBlockHeight(); // Start the fetch process
            </script>
8{"p":"brc-20","op":"transfer","tick":"tstr","amt":"100"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"satx","amt":"100000000000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"satx","amt":"569999999208"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"BTCs","amt":"500"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"FTAI","amt":"20000000"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":".ant","amt":"1850000000"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"mmwa","amt":"6000000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"BTCs","amt":"500"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"insc","amt":"2000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"50000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"BTCs","amt":"500"}h!
text/html;charset=utf-8
K/content/c30b4d7454d06583d7cf2f9506e434ecc3b204debd578a781ed079091a71f632i0h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"VSAD","amt":"2500"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1500000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"satx","amt":"50000000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"core","amt":"2000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"20000000000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"23200000000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"50000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"AINN","amt":"3000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"satx","amt":"50000000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"BTCs","amt":"300"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"77777777777"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"$DOG","amt":"173808000000"}h!
GjE=:ETH.USDT-EC7:0x39708921cbbC783D65834C1C723A0d7f9669E313:0/1/0:ti:70
Lu<!DOCTYPE html><script 3129 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
GjE=:ETH.USDT-EC7:0x107F6C68B86d6dB33911B1C1Ec8F70B9859d03D6:0/1/0:ti:70
Bj@=:ETH.ETH:0xDecb03Ba04AF719F87d4227e7c627F5E42D72db0:0/1/0:ti:70
text/plain;charset=utf-8
C{"p":"brc-20","op":"transfer","tick":"Dovi","amt":"11508.61525153"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"66666666666"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"BTCs","amt":"300"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"roup","amt":"559000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"MMSS","amt":"6400"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"merm","amt":"3000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"@LFG","amt":"31610"}h!
Lu<!DOCTYPE html><script 3106 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3125 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3051 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
,j*0x347872569043f0373acccbcedf0f2c12f8c944ae
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841611"}h!
Lu<!DOCTYPE html><script 3155 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3167 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"piza","amt":"41"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"piza","amt":"92"}h!
Lu<!DOCTYPE html><script 3144 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3109 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3115 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3128 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3164 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
GjE=:ETH.USDT-EC7:0x627C7E8dB9b0B4203A85CA2e7c37Fe97b5d172f9:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0xE96c4a2C1E69aD03db8f2986b2083f414a694421:0/1/0:ti:70
#j!for user U000001316 april payment
Lu<!DOCTYPE html><script 3165 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3127 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
,j*0x18bF06ea6Cd02Fae1d0a555F676e3de5864A946D
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"@LFG","amt":"5000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"100"}h!
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"612c2e583dcf5cceaa41d0bf618a24fbcd8cf1b29d86fdaaec2617f6aa110984","iid":"QrAzuki (Free Mint)","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":5046,"minter":"bc1phktelagzdmxe84td6urxuck0gt0s60nm5wzc8u22e55uge3m4qyqejvjrt","sig":"HDr8eaoxt6/Ebczbtpp1UNL3oNgyfRwHV80UFKylPu6dGRDGO4PzpvFWTNeanZwwsBaTBMtOgcQ/cYJEKj1aLxY="}hA
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"10000000000"}h!
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3147 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3172 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3145 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3148 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/html;charset=utf-8
    <meta charset="UTF-8">
    <!-- BlockPepes-Runes-140 -->
            margin: 0;
            padding: 0;
            height: 100%;
            width: 100%;
        #canvas-frame {
            display: flex;
            justify-content: center;
            align-items: center;
            height: 100%;
            width: 100%;
            background: #ff5100;
        #svg-container {
            max-width: 100%M
            max-height: 100%;
    <div id="canvas-frame">
        <div id="svg-container">
            <script defer>
                const imageUrls = ["/content/ebb7ceb79c597a09e1df8b35a408d1d9322335e5d0e8fbaae06cd904304fb28ei0",
                    "/content/281c0fb2672fc1bbc440ef86b8a645209b3a49f66e6b16f31aad4979711cda4ei0",
                    "/content/395d2c62a9dab5979955c9d9390d6f32e15c90bd6a4bae812ee5c8fa2a9abd98i0"];
                const svg = document.createElemeM
ntNS("http://www.w3.org/2000/svg", "svg");
                svg.setAttribute("viewBox", "0 0 250 250");
                svg.style.width = "100%";
                svg.style.height = "100%";
                imageUrls.forEach((url) => {
                    const img = document.createElementNS("http://www.w3.org/2000/svg", "image");
                    img.setAttribute("href", url);
                    img.setAttribute("width", "245");
                    img.setAttribute("height", "245");
                    img.style.M
imageRendering = "pixelated";
                    svg.appendChild(img);
                document.getElementById("svg-container").appendChild(svg);
                let currentBlock = null;
                const fetchBlockHeight = () => {
                    fetch("/r/blockheight")
                        .then(res => res.text())
                        .then(data => {
                            const newBlock = parseInt(data, 10);
                            if (newBlock !== currentBlock) {
                             currentBlock = newBlock;
                                startEffect(10000);
                            }
                        })
                        .finally(() => setTimeout(fetchBlockHeight, 5000));
                const startEffect = (duration) => {
                    let hue = 50, brightness = 85, direction = 20;
                    const rotate = setInterval(() => {
                        hue = (hue + 1) % 360;
                        brightness += diM
                        if (brightness >= 200 || brightness <= 50) direction *= -1;
                        updateFilter(hue, brightness);
                    }, 50);
                    setTimeout(() => {
                        clearInterval(rotate);
                        updateFilter(0, 100);
                    }, duration);
                const updateFilter = (hue, brightness) => {
                    const imgs = document.getElementsByTagName("image");
                    if (L
imgs.length > 0) imgs[0].style.filter = `brightness(${brightness}%) hue-rotate(${hue}deg) saturate(100%)`;
                fetchBlockHeight(); // Start the fetch process
            </script>
Lu<!DOCTYPE html><script 3150 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3110 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"15298425590"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"ordi","amt":"2099.2"}h!
DjB=:BTC/BTC:thor17unftkdeuwcyqrsx32wpzqsmjjyl7ym5na5fqf:96893300/1/0
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"ordi","amt":"1099.2"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"ordi","amt":"88.18"}h!
GjE=:ETH.USDT-EC7:0xf8EBe56cf81082A54D60e6a9779D88df5C861616:0/1/0:ti:70
SjLP=:s:0x1b96935368c33cab8d2cd9c541872677979b857b:607342600:t:15:2E:955:32911546513
text/plain; charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"trac","amt":"65"}h!
text/plain; charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"trac","amt":"104"}h!
text/plain; charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"trac","amt":"1000"}h!
text/plain; charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"trac","amt":"14830"}h!
text/plain; charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"trac","amt":"300"}h!
text/plain; charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"trac","amt":"150"}h!
text/plain; charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"trac","amt":"5990"}h!
text/plain; charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"trac","amt":"54"}h!
text/plain; charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"trac","amt":"1100"}h!
text/plain; charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"trac","amt":"150"}h!
text/plain; charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"trac","amt":"100"}h!
text/plain; charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"trac","amt":"2102"}h!
text/plain; charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"trac","amt":"190"}h!
text/plain; charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"trac","amt":"5222"}h!
text/plain; charset=utf-8
F{"p":"brc-20","op":"transfer","tick":"rats","amt":"28183221.89610483"}h!
text/plain; charset=utf-8
C{"p":"brc-20","op":"transfer","tick":"rats","amt":"15700839.51313"}h!
text/plain; charset=utf-8
E{"p":"brc-20","op":"transfer","tick":"rats","amt":"6526226.23277959"}h!
text/plain; charset=utf-8
E{"p":"brc-20","op":"transfer","tick":"rats","amt":"1446307761.74067"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"rats","amt":"2001000000"}h!
text/plain; charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"rats","amt":"9938006.95315"}h!
text/plain; charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"rats","amt":"8505028.38074"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"rats","amt":"2024000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"rats","amt":"1160000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"rats","amt":"7845800000"}h!
text/plain; charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"rats","amt":"8054077.3004"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"rats","amt":"1165109600"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"6000000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"74499999"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"2300000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"50000000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"9999999"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"2450000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"22326687"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"4299000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"20000000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"19999999"}h!
text/plain; charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"rats","amt":"200000000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"10000000"}h!
text/plain; charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"rats","amt":"497000000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"6000000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"4999999"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"4155578"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"8000000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"9486977"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"5000000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"86625000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"8000000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"26000000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"13000000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"44000000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"9999999"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"6000000"}h!
text/plain; charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"rats","amt":"348333334"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"40000000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"5000000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"4999999"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"24000000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"59000000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"9900000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"15000000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"2100000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"50000000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"6000000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"35020000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"10000000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"25240781"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"8000000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"3320039"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"1000000"}h!
text/plain; charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"rats","amt":"184000000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"3000000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"6000000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"10000000"}h!
text/plain; charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"rats","amt":"349908770"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"41000000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"10000000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"55000000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"36000000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"5000000"}h!
text/plain; charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"rats","amt":"129628380"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"8113250"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"20000000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"10540307"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"10000000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"4999999"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"10000000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"2000000"}h!
text/plain; charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"rats","amt":"115555555"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"6000000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"48000000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"3000000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"40000000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"2500000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"2000000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"9999999"}h!
text/plain; charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"rats","amt":"900000"}h!
text/plain; charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"rats","amt":"100000000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"20000000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"10000000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"4999999"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"3000000"}h!
text/plain; charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"rats","amt":"102128861"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"20000000"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"5000000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"13883149"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"5500000"}h!
text/plain; charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"sats","amt":"2109459343378"}h!
text/plain; charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"sats","amt":"2000000000000"}h!
text/plain; charset=utf-8
G{"p":"brc-20","op":"transfer","tick":"sats","amt":"150000000000.61426"}h!
text/plain; charset=utf-8
C{"p":"brc-20","op":"transfer","tick":"sats","amt":"3999999999.999"}h!
text/plain; charset=utf-8
C{"p":"brc-20","op":"transfer","tick":"sats","amt":"1215227720.944"}h!
text/plain; charset=utf-8
C{"p":"brc-20","op":"transfer","tick":"sats","amt":"5719244555.848"}h!
text/plain; charset=utf-8
C{"p":"brc-20","op":"transfer","tick":"sats","amt":"4987012098.777"}h!
text/plain; charset=utf-8
D{"p":"brc-20","op":"transfer","tick":"sats","amt":"8010227067.4444"}h!
text/plain; charset=utf-8
D{"p":"brc-20","op":"transfer","tick":"sats","amt":"14726061768.773"}h!
text/plain; charset=utf-8
D{"p":"brc-20","op":"transfer","tick":"sats","amt":"14298420305.462"}h!
text/plain; charset=utf-8
D{"p":"brc-20","op":"transfer","tick":"sats","amt":"2632374543.7896"}h!
text/plain; charset=utf-8
E{"p":"brc-20","op":"transfer","tick":"sats","amt":"10424234381.2976"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"1000000000"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"70000000000"}h!
text/plain; charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"ordi","amt":"113.77405004"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"29000088888"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"2528432531"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"10000000000"}h!
text/plain; charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"sats","amt":"200000000000"}h!
text/plain; charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"sats","amt":"3483693879.76"}h!
text/plain; charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"sats","amt":"4000000000.57"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"1342093072"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"39200000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"1100000000"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"89000000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5950000000"}h!
text/plain; charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"sats","amt":"523120967080"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"1000000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"4373158729"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"15337489080"}h!
text/plain; charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"ordi","amt":"1100.64405064"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"2000000000"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"53989711140"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"1000000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"1000000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5950000000"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"10000000000"}h!
text/plain; charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"sats","amt":"3983394588.85"}h!
text/plain; charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"sats","amt":"332779000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"2000000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"6085289370"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"1300000000"}h!
text/plain; charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"ordi","amt":"120.96007832"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5400000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"1000000000"}h!
text/plain; charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"sats","amt":"671869216.322"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"2000000000"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"30000000000"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"59542835410"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"22300000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"8211111211"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"3500000000"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"50000000000"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"10000000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"2000000000"}h!
text/plain; charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"sats","amt":"810487756.69"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"30000000000"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"67058806920"}h!
text/plain; charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"sats","amt":"3486867448.78"}h!
text/plain; charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"sats","amt":"181000000000"}h!
text/plain; charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"ordi","amt":"198.72103794"}h!
text/plain; charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"sats","amt":"2000000000.43"}h!
text/plain; charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"ordi","amt":"1281.09120677"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"11600000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"9950010040"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"1000000000"}h!
text/plain; charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"sats","amt":"3483672758.54"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"11766666666"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"14868349655"}h!
text/plain; charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"ordi","amt":"7489.47227231"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"1500000000"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"10000000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"1300000000"}h!
text/plain; charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"sats","amt":"2000000000.13"}h!
text/plain; charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"sats","amt":"4348977370.57"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"31000000000"}h!
text/plain; charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"sats","amt":"747593445.245"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"4934735890"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"2100000000"}h!
text/plain; charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"sats","amt":"3486844990.13"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"2000000000"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"19818000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"7500000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"1000000000"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"10000000000"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"11334057428"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"1100000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"2100000000"}h!
text/plain; charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"sats","amt":"3486857380.67"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"3800000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5699999996"}h!
text/plain; charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"10600000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"2200000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"2000000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"2100000000"}h!
text/plain; charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"1007218380"}h!
text/plain; charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"sats","amt":"999950000"}h!
text/plain; charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"sats","amt":"100000000"}h!
text/plain; charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"sats","amt":"200000000"}h!
text/plain; charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"sats","amt":"500000000"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"ordi","amt":"8.237172"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"ordi","amt":"60.20674"}h!
text/plain; charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"ordi","amt":"229.62"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"ordi","amt":"2009.46"}h!
text/plain; charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"ordi","amt":"31998.4"}h!
text/plain; charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"ordi","amt":"250"}h!
text/plain; charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"ordi","amt":"61"}h!
text/plain; charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"ordi","amt":"12890"}h!
text/plain; charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"ordi","amt":"29.8"}h!
text/plain; charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"ordi","amt":"250"}h!
text/plain; charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"ordi","amt":"10"}h!
text/plain; charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"ordi","amt":"1000"}h!
text/plain; charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"ordi","amt":"274"}h!
text/plain; charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"ordi","amt":"50"}h!
text/plain; charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"ordi","amt":"9.87"}h!
text/plain; charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"ordi","amt":"10"}h!
text/plain; charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"ordi","amt":"30"}h!
text/plain; charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"ordi","amt":"300"}h!
text/plain; charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"ordi","amt":"32"}h!
text/plain; charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"ordi","amt":"75"}h!
text/plain; charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"ordi","amt":"86"}h!
text/plain; charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"ordi","amt":"600"}h!
text/plain; charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"ordi","amt":"10"}h!
text/plain; charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"ordi","amt":"21.4"}h!
text/plain; charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"ordi","amt":"5000"}h!
text/plain; charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"ordi","amt":"13.04"}h!
text/plain; charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"ordi","amt":"90"}h!
text/plain; charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"ordi","amt":"1500"}h!
text/plain; charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"ordi","amt":"50"}h!
text/plain; charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"ordi","amt":"25"}h!
text/plain; charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"ordi","amt":"9.2"}h!
text/plain; charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"ordi","amt":"71.8"}h!
text/plain; charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"ordi","amt":"450"}h!
text/plain; charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"ordi","amt":"9.2"}h!
text/plain; charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"ordi","amt":"20.44"}h!
text/plain; charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"ordi","amt":"97.58"}h!
text/plain; charset=utf-8
={"p":"brc-20","op":"transfer","tick":"ordi","amt":"11985.82"}h!
text/plain; charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"rcsv","amt":"500"}h!
text/plain; charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"rcsv","amt":"3000"}h!
text/plain; charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"rcsv","amt":"3000"}h!
text/plain; charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"rcsv","amt":"35000"}h!
GjE=:ETH.USDC-B48:0x6076fc7f6523E4FF5560490a854A3090d18F28c5:0/1/0:ti:70
Bj@=:ETH.ETH:0xd5E4dC2D0d6666E6A5D6B6Ec9cBa4923E30E19bb:0/1/0:ti:70
Bj@=:ETH.ETH:0xEb20Fe5F72289B01c3FC8fAF0f94537379d27BC2:0/1/0:ti:70
Bj@=:BSC.BNB:0x0676F87ba79aF24879EbF24D0de2Fd41D859a28e:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0x952B36a0f9ABF977E597f762326EC4bCe79fB87b:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0xC12d7276C5f0D4Ef464346Fce300706b072Cba4F:0/1/0:ti:70
GjE=:BSC.USDT-955:0x95E7d080830cBbb499fC4BaA01Ab0c4FDA69eE89:0/1/0:ti:70
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"PUPS","amt":"100"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"1000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"1000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"$DOG","amt":"25000000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"2000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"1900"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"deai","amt":"2100"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"1000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"core","amt":"2600"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"300008888880"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"sxio","amt":"6000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"deai","amt":"2100"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"zbit","amt":"500"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"mmwa","amt":"5000000000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"ordi","amt":"730.31130998"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"1000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"2000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"7000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"csas","amt":"60000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"3000"}h!
""""""""""""""""""""""""""""""""S
DjB=:BTC/BTC:thor1aqqn36tf54tjj6qtr79ke5methxvvx8g6g0tyu:48000000/1/0~
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"FRAM","amt":"11111"}h!
text/plain;charset=utf-8
C{"p":"brc-20","op":"transfer","tick":"SHID","amt":"10000000000000"}h!
Lu<!DOCTYPE html><script 3193 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3061 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3119 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/html;charset=utf-8
Lj<script s=2119 src="/content/fda76f25fec711cfcba7679df76d2a8a7f406585aff62ed00d337db5de505b7ei0"></script>h
text/html;charset=utf-8
Lj<script s=2120 src="/content/fda76f25fec711cfcba7679df76d2a8a7f406585aff62ed00d337db5de505b7ei0"></script>h
text/html;charset=utf-8
Lj<script s=2121 src="/content/fda76f25fec711cfcba7679df76d2a8a7f406585aff62ed00d337db5de505b7ei0"></script>h
text/html;charset=utf-8
Lj<script s=2122 src="/content/fda76f25fec711cfcba7679df76d2a8a7f406585aff62ed00d337db5de505b7ei0"></script>h
text/html;charset=utf-8
Lj<script s=2123 src="/content/fda76f25fec711cfcba7679df76d2a8a7f406585aff62ed00d337db5de505b7ei0"></script>h
text/html;charset=utf-8
Lj<script s=2124 src="/content/fda76f25fec711cfcba7679df76d2a8a7f406585aff62ed00d337db5de505b7ei0"></script>h
text/html;charset=utf-8
Lj<script s=2125 src="/content/fda76f25fec711cfcba7679df76d2a8a7f406585aff62ed00d337db5de505b7ei0"></script>h
text/html;charset=utf-8
Lj<script s=2126 src="/content/fda76f25fec711cfcba7679df76d2a8a7f406585aff62ed00d337db5de505b7ei0"></script>h
text/html;charset=utf-8
Lj<script s=2127 src="/content/fda76f25fec711cfcba7679df76d2a8a7f406585aff62ed00d337db5de505b7ei0"></script>h
text/html;charset=utf-8
Lj<script s=2128 src="/content/fda76f25fec711cfcba7679df76d2a8a7f406585aff62ed00d337db5de505b7ei0"></script>h
text/html;charset=utf-8
Lj<script s=2129 src="/content/fda76f25fec711cfcba7679df76d2a8a7f406585aff62ed00d337db5de505b7ei0"></script>h
text/html;charset=utf-8
Lj<script s=2130 src="/content/fda76f25fec711cfcba7679df76d2a8a7f406585aff62ed00d337db5de505b7ei0"></script>h
text/html;charset=utf-8
Lj<script s=2131 src="/content/fda76f25fec711cfcba7679df76d2a8a7f406585aff62ed00d337db5de505b7ei0"></script>h
text/html;charset=utf-8
Lj<script s=2132 src="/content/fda76f25fec711cfcba7679df76d2a8a7f406585aff62ed00d337db5de505b7ei0"></script>h
text/html;charset=utf-8
Lj<script s=2133 src="/content/fda76f25fec711cfcba7679df76d2a8a7f406585aff62ed00d337db5de505b7ei0"></script>h
text/html;charset=utf-8
Lj<script s=2134 src="/content/fda76f25fec711cfcba7679df76d2a8a7f406585aff62ed00d337db5de505b7ei0"></script>h
text/html;charset=utf-8
Lj<script s=2135 src="/content/fda76f25fec711cfcba7679df76d2a8a7f406585aff62ed00d337db5de505b7ei0"></script>h
text/html;charset=utf-8
Lj<script s=2136 src="/content/fda76f25fec711cfcba7679df76d2a8a7f406585aff62ed00d337db5de505b7ei0"></script>h
text/html;charset=utf-8
Lj<script s=2137 src="/content/fda76f25fec711cfcba7679df76d2a8a7f406585aff62ed00d337db5de505b7ei0"></script>h
text/html;charset=utf-8
Lj<script s=2138 src="/content/fda76f25fec711cfcba7679df76d2a8a7f406585aff62ed00d337db5de505b7ei0"></script>h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841612"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"core","amt":"20356"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"1000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"3900"}h!
text/html;charset=utf-8
<script data-s="0x96816c49a844c35be81f387caa4a6d9778bfa6718065bbe7b2afea2b9cea8643" src="/content/f80b93466a28c5efc703fab02beebbf4e32e1bc4f063ac27fedfd79ad982f2cei0"></script><body style="display: none"></body>
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3209 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3221 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3137 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"4998"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"2000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"3000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"3400"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"250000000000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"200000000000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"mice","amt":"800000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"DepD","amt":"500000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"TFER","amt":"10000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"150000000000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"satx","amt":"100000000008"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"5000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"ordi","amt":"10"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"slor","amt":"22387.88"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"77777777777"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"66666666666"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"1980"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"55555555555"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"120000000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"4000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"ordi","amt":"5961.5133526"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"PUPS","amt":"50"}h!
L_{"p":"brc20-s","op":"mint","amt":"2203.445258507588774356","pid":"0a4585a069#e6","tick":"btcs"}h!
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"O4DX","amt":"7272.72"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"VMPX","amt":"540"}h!
<j:=:DOGE.DOGE:DLmxiny129LMDDZhLGHJSVJgbgShgGxhNt:0/1/0:td:70
text/plain;charset=utf-8
K{"p":"brc-20","op":"transfer","tick":"ornj","amt":"47124.1726200000000000"}h!
GjE=:ETH.USDT-EC7:0xfaec099ea21Ea7ee78c0b5a5C2581aA931A3d064:0/1/0:ti:70
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
GjE=:ETH.USDT-EC7:0x0B8dC22607a8852c213c7E5567a48AE9a857DE72:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0x599389195c29F02930c90f90605BA8120a07F40B:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0x0ad73cFE142ed6A0A5Cc0a29c4d62fF677a7d323:0/1/0:ti:70
Bj@=:ETH.ETH:0x85c58628524Dfc2F348560E50f0d853E126C66A2:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0x95A8D0b56e38791770Fe78798C8B280fF574DD59:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0xAE8256e4C53D97aD6c7c5A0170be884dBa73A0B8:0/1/0:ti:70
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"1000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"25000"}h!
OjLL=:ETH/DAI:thor1wdrk80rq9egdmgwezsal9s2x7kwq4wh8tdlw8w:855963338145/3/30:t:30uFm
Bj@=:ETH.ETH:0xF563f7cbCD0fCd8A7ec59c79EB0b335E3fe06767:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0x122921E434de99e86bd98BD0d84178A3d50C2211:0/1/0:ti:70
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"Stoe","amt":"200"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"1000"}h!
Lu<!DOCTYPE html><script 3077 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3200 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"trac","amt":"1000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"1000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"tope","amt":"1998"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"3000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"VMPX","amt":"2840"}h!
text/plain;charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"piin","amt":"100000000"}h!
Lu<!DOCTYPE html><script 3227 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3206 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"wawa","amt":"168000"}h!
text/plain;charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"rats","amt":"100000000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"merm","amt":"22900000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"541"}h!
text/html;charset=utf-8
<script data-s="0x0f8da3b8cbcd797410b7ed7f7dc5b164f41015600e704f44b839d0fb337e7a27" src="/content/f80b93466a28c5efc703fab02beebbf4e32e1bc4f063ac27fedfd79ad982f2cei0"></script><body style="display: none"></body>
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"900"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"900"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"900"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"satx","amt":"100000000008"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"$DOG","amt":"25000000000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"satx","amt":"20000000000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"BTBD","amt":"50000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"900"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"1000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"core","amt":"50000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"trac","amt":"1000"}h!
Lu<!DOCTYPE html><script 3066 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841613"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"900"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"5000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"900"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"1500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"900"}h!
   !!!"""###$$$%%%&&&'''((()))***+++,,,---...///000111222333444555666777888999:::;;;<<<===>>>???@@@AAABBBCCCDDDEEEFFFGGGHHHIIIJJJKKKLLLMMMNNNOOOPPPQQQRRRSSSTTTUUUVVVWWWXXXYYYZZZ[[[\\\]]]^^^___```aaabbbcccdddeeefffggghhhiiijjjkkklllmmmnnnooopppqqqrrrssstttuuuvvvwwwxxxyyyzzz{{{|||}}}~~~
>iTXtXML:com.adobe.xmp
" id="W5M0MpCehiHzreSzNTczkc9d"?> <x:xmpmeta xmlns:x="adobe:ns:meta/" x:xmptk="Adobe XMP Core 9.0-c001 79.14ecb42, 2022/12/02-19:12:44        "> <rdf:RDF xmM
lns:rdf="http://www.w3.org/1999/02/22-rdf-syntax-ns#"> <rdf:Description rdf:about="" xmlns:xmpMM="http://ns.adobe.com/xap/1.0/mm/" xmlns:stEvt="http://ns.adobe.com/xap/1.0/sType/ResourceEvent#" xmlns:stRef="http://ns.adobe.com/xap/1.0/sType/ResourceRef#" xmlns:dc="http://purl.org/dc/elements/1.1/" xmlns:photoshop="http://ns.adobe.com/photoshop/1.0/" xmlns:xmp="http://ns.adobe.com/xap/1.0/" xmlns:tiff="http://ns.adobe.com/tiff/1.0/" xmlns:exif="http://ns.adobe.com/exif/1.0/" xmpMM:DocumentID="adobe:docid:photoshop:bM
0e9dced-42e7-5940-b88a-0c0e9d2dafd3" xmpMM:InstanceID="xmp.iid:af4b7850-f0f1-fa43-98f5-e5a802a7cb15" xmpMM:OriginalDocumentID="4B4798EDE5596DBB11C972DBD2AA8330" dc:format="image/png" photoshop:LegacyIPTCDigest="CDCFFA7DA8C7BE09057076AEAF05C34E" photoshop:ColorMode="2" xmp:CreateDate="2024-04-30T17:06:05-07:00" xmp:MetadataDate="2024-04-30T23:31:27-07:00" xmp:ModifyDate="2024-04-30T23:31:27-07:00" xmp:CreatorTool="Adobe Photoshop 24.2 (Windows)" tiff:ImageWidth="600" tiff:ImageLength="600" tiff:PhotometricInterpretaM
tion="1" tiff:Orientation="1" tiff:SamplesPerPixel="4" tiff:XResolution="590000/10000" tiff:YResolution="590000/10000" tiff:ResolutionUnit="3" exif:ExifVersion="0231" exif:ColorSpace="1" exif:PixelXDimension="77" exif:PixelYDimension="77"> <xmpMM:History> <rdf:Seq> <rdf:li stEvt:action="saved" stEvt:instanceID="xmp.iid:60df1621-c641-a940-9065-6a8b1b2e1bfc" stEvt:when="2024-04-30T23:23:26-07:00" stEvt:softwareAgent="Adobe Photoshop 24.2 (Windows)" stEvt:changed="/"/> <rdf:li stEvt:action="saved" stEvt:instanceID="xmM
p.iid:fe29a5e9-0d03-d747-bdaf-03a0ccb5816c" stEvt:when="2024-04-30T23:31:27-07:00" stEvt:softwareAgent="Adobe Photoshop 24.2 (Windows)" stEvt:changed="/"/> <rdf:li stEvt:action="converted" stEvt:parameters="from image/jpeg to image/png"/> <rdf:li stEvt:action="derived" stEvt:parameters="converted from image/jpeg to image/png"/> <rdf:li stEvt:action="saved" stEvt:instanceID="xmp.iid:af4b7850-f0f1-fa43-98f5-e5a802a7cb15" stEvt:when="2024-04-30T23:31:27-07:00" stEvt:softwareAgent="Adobe Photoshop 24.2 (Windows)" stEvtM
:changed="/"/> </rdf:Seq> </xmpMM:History> <xmpMM:DerivedFrom stRef:instanceID="xmp.iid:fe29a5e9-0d03-d747-bdaf-03a0ccb5816c" stRef:documentID="adobe:docid:photoshop:05a76fbd-9714-c94b-9cf1-5af549800d4a" stRef:originalDocumentID="4B4798EDE5596DBB11C972DBD2AA8330"/> <photoshop:DocumentAncestors> <rdf:Bag> <rdf:li>0F99EE80A8B07153112954B9AA5498D8</rdf:li> </rdf:Bag> </photoshop:DocumentAncestors> <tiff:BitsPerSample> <rdf:Seq> <rdf:li>8</rdf:li> <rdf:li>8</rdf:li> <rdf:li>8</rdf:li> <rdf:li>8</rdf:li> </rdf:Seq> </tiM
ff:BitsPerSample> </rdf:Description> </rdf:RDF> </x:xmpmeta> <?xpacket end="r"?>
33333333333333333333333333333333S
,j*0x76d4b0812445ace8db83031e495e6997542edc48
,j*0xf4cfbcd25b93f2ab66072ad8df58e40ba81d673d
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"1000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"1500"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"SATS","amt":"2752280216"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"trac","amt":"7564"}h!
text/plain;charset=utf-8
6{"p":"b137","op":"did-bind","tld":"ink","name":"hugh"}h!
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3159 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"andy","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"andy","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"andy","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"andy","amt":"1000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"BTCs","amt":"400"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"6283000000"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5000000000"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5000000000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"andy","amt":"1000"}h!
Lu<!DOCTYPE html><script 3170 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3195 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3179 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3169 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3146 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3175 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
H{"p":"src-721","op":"mint","c"J
 :"A936188709190814927","ts":[0,3J
K{"p":"src-721","op":"mint","c"J
 :"A936188709190814927","ts":[11,J
Lu<!DOCTYPE html><script 3176 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3181 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3188 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3133 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
C{"p":"brc-20","op":"deploy","tick":"Tsea","max":"1200","lim":"600"}h!
;j9=:e:0xcef3a0431f90c449f4b9e0eb809d5f87d358da1d:0/1/0:dx:0J
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"ordi","amt":"27.81"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"ordi","amt":"106.4216413"}h!
GjE=:ETH.USDT-EC7:0xF98E8CEaf3AC22C5a58D650755f2F84398E40e8E:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0x0dFf0a835dD671Dda406408Ca6925099FDF3E8b1:0/1/0:ti:70
text/plain;charset=utf-8
K{"p":"brc-20","op":"transfer","tick":"vmpx","amt":"15820.9824379000000000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"piza","amt":"97"}h!
Bj@=:ETH.ETH:0x35d94F44895ac9Cf6DBe21a232Fbf69b9D5d6Fa1:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0x19F6ffF79346018600C2e1fD99bb0b18C6F7298a:0/1/0:ti:70
Lu<!DOCTYPE html><script 3154 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3162 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3177 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3208 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3182 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
dnamegRM #202jattributes
jtrait_typebBGevalueebg 05
jtrait_typedBodyevaluegbody 03
jtrait_typebEEevaluerelectric effect 02
jtrait_typeeFrameevaluehframe 01
jtrait_typegMonitorevaluekmonitor  03
jtrait_typefSymbolevalueaF
jtrait_typedTypeevaluegtype 01
dnamegRM #285jattributes
jtrait_typebBGevalueebg 02
jtrait_typedBodyevaluegbody 07
jtrait_typebEEevaluerelectric effect 02
jtrait_typeeFrameevaluehframe 01
jtrait_typegMonitorevaluekmonitor  02
jtrait_typefSymbolevalueaW
jtrait_typedTypeevaluegtype 01
dnamegRM #319jattributes
jtrait_typebBGevalueebg 04
jtrait_typedBodyevaluegbody 11
jtrait_typebEEevaluerelectric effect 01
jtrait_typeeFrameevaluehframe 01
jtrait_typegMonitorevaluejmonitor 01
jtrait_typefSymbolevalueaK
jtrait_typedTypeevaluegtype 01
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"W
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"SIMF","amt":"10000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"satx","amt":"30000000000"}h!
text/plain;charset=utf-8
C{"p":"brc-20","op":"transfer","tick":"Dovi","amt":"11508.61525153"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"defi","amt":"24000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"slor","amt":"999"}h!
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"sbbs","amt":"5688888888888"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"core","amt":"2000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"corn","amt":"9900"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"BTCs","amt":"100"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"satx","amt":"100000000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"5000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"trac","amt":"518"}h!
K/content/50c376da2ddaead36de2ab547057061e983c8fd798494af561226a4e9e5d0afbi0h!
K/content/50c376da2ddaead36de2ab547057061e983c8fd798494af561226a4e9e5d0afbi0h!
K/content/50c376da2ddaead36de2ab547057061e983c8fd798494af561226a4e9e5d0afbi0h!
K/content/50c376da2ddaead36de2ab547057061e983c8fd798494af561226a4e9e5d0afbi0h!
K/content/50c376da2ddaead36de2ab547057061e983c8fd798494af561226a4e9e5d0afbi0h!
33333333333333333333333333333333S
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"MTMT","amt":"5000"}h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841614"}h!
Lu<!DOCTYPE html><script 3135 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
,j*0x954c9812D1775f259C562Daf038FF8eeBAF4f89F
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"PUPS","amt":"50"}h!
text/plain;charset=utf-8
={"p":"tap","op":"token-transfer","tick":"-tap","amt":"50000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"ordi","amt":"76.255246830"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"piza","amt":"500"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
8{"p":"b137","op":"did-bind","tld":"ink","name":"zombie"}h!
text/plain;charset=utf-8
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3116 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3123 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3214 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3153 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3198 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3205 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3163 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3219 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3134 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3191 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3190 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3194 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"trac","amt":"1000"}h!
text/plain;charset=utf-8
/ViaBTC/Mined by miningkrs/,
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"ordi","amt":"1928.86913041"}h!
FjDOUT:B14A9A79AF9AF8B13802DC8107CC45CFA1A577CC3EF5CE3A1389EC981A9D2851
QjLN=:ETH.USDC:0xCeF3a0431F90C449f4B9E0eB809d5f87D358da1d:11120170922800/3/26:t:30
FjDOUT:3B609A024859000B6D34AC42FA342D9080071C0720F1E326F76081BF209C7E81
FjDOUT:708A46E111F6E23D8B82CC83BA0C51A6750392FAC99D24EED8D875F5EBEC0535
FjDOUT:6B5B2CBDF1EC60477A4DA28ED9BA677407E808F5D41B808B17D1D9D83D0D4829
FjDOUT:12A36AD55084732F5D7AE02D3F3BA2A5B1899AAE8DADDA2DC54B7EE2FB956CE2
Bj@=:ETH.ETH:0xAf45ae584c5Ac2a7FaF488226c2B27fd6ed22A5D:0/1/0:ti:70
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"Sqts","amt":"666666666666"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"FRAM","amt":"25000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"1000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"180000000000"}h!
text/plain;charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"sats","amt":"999999999"}h!
Bj@=:BSC.BNB:0x68fF9B12cA724a2cC6b5609f8f5aAcEC041CF736:0/1/0:td:70
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"core","amt":"13500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"slor","amt":"499"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"22000000000"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"2752280216"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"PUPS","amt":"20"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"Mirac","amt":"800000000"}h!
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"ethi","amt":"230000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"ordi","amt":"62.53395375"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5950000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1000000"}h!
text/html;charset=utf-8
<script data-s="0xe740a49e4f1438c631c02a02381c1d5b00debded29a0b93efcc2aa106daa8d52" src="/content/f80b93466a28c5efc703fab02beebbf4e32e1bc4f063ac27fedfd79ad982f2cei0"></script><body style="display: none"></body>
Lu<!DOCTYPE html><script 3185 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841615"}h!
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3124 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3189 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"NODE","amt":"3000"}h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3186 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3174 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
text/plain;charset=utf-8
6{"p":"brc-20","op":"transfer","tick":"ordi","amt":"2"}h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3180 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3178 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"satx","amt":"25000000000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"trac","amt":"1000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"sats","amt":"299000000000"}h!
:{"p":"pow-20","op":"transfer","tick":"DOTI","amt":"30000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"cats","amt":"20000"}h!
text/plain;charset=utf-8
LW{"op":"transfer","p":"orc-20","params":{"amt":"153824.9846175","tick":"poi","tid":"1"}}h!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
GjE=:ETH.USDC-B48:0x83e112798027c6BF6fcdadB0Bd063955894252B4:0/1/0:ti:70
text/plain;charset=utf-8
72371a2d9dcd89bb02h!
Lu<!DOCTYPE html><script 3103 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3139 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3160 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3157 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3166 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3171 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3152 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3151 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3149 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3158 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3136 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
1f/Foundry USA Pool #dropgold/F
HjF=:ETH.WBTC:0xd66932532fe11a74ec7d8525a15753bad714c086:9656285/3/2:t:30
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"ordi","amt":"10.12"}h!
EjC=:BTC/BTC:thor17unftkdeuwcyqrsx32wpzqsmjjyl7ym5na5fqf:172039200/1/0
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
:{"amt":"27.81","op":"transfer","p":"brc-20","tick":"ordi"}h!
QjLN=:ETH.USDC:0xCeF3a0431F90C449f4B9E0eB809d5f87D358da1d:11111101128700/3/26:t:30
FjDOUT:8E1C8EEBC974EAD136ADAF0C9C9AC448C2FB7EA45F7332214A9EFBBC396B6D04
FjDOUT:EB9419C62913C6F868A11F87B9AECB6CDCD1A9E264764FF941FB41C3F135F5C3
FjDOUT:5DEB89901A0F5D6D764719A052AF5D47E1385FA10030B2F57FF771C524B6DED1
FjDOUT:72AC8E0EF83F707AC8927252C5F7487BFC2839D51BD7FD1D2AC16374321EC049
GjE=:ETH.USDT-EC7:0xF85E5bc5700f2d82C25d3b5a5955c100945A8251:0/1/0:ti:70
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"ligo","amt":"89936250.39"}h!
K/content/b9573f72685eedf61ce302776b71943bfffc45e0e00036d61d32b98f88ddd234i0h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"trac","amt":"10000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"slor","amt":"990"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5950000000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"satx","amt":"350000000000"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5950000000"}h!
text/plain;charset=utf-8
E{"p":"brc-20","op":"transfer","tick":"sats","amt":"20477288755.7236"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5950000000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"DNCX","amt":"200000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"PGID","amt":"996"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5950000000"}h!
GjE=:ETH.USDT-EC7:0x54c9816313c1B65eD63840c41fd06e9176641A91:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0xa644c7FDCa07BF992173B3CfC8FA2d1A2442ec2b:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0xDFf41c41908B8D5e886d52Fe0FAD4b6b9cbeA1D5:0/1/0:ti:70
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"22000000000"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5950000000"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5950000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5950000000"}h!
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":896,"minter":"bc1pzneedxacl5syjtnmf80q7ghsr6ysvh6le75u7wcqfgfy8y5wq29ssma4w5","sig":"HCVFpcUj1iFfrHHMtC5YNBSNMaXcmi63JXHwqWBqgWBCfULbg04moIU0iQW4feRWFDimZkHi7QJcQgTIBKiDRkg="}hA
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"PUPS","amt":"20"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"PGID","amt":"999"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"srvs","amt":"7708"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"SIMF","amt":"10000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"1890"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5950000000"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5950000000"}h!
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":2049,"minter":"bc1psu4taznhacg039cpt7r52gcja0ynn6p9ttkz85aqmywvkp2avv2qgnwear","sig":"G9bo6YYiYwJKCkjlWLonGyRBykGA7maf3k7K7bJ9DtPLUeX2s6bBT8kQhA3LpuuMLss/T+uynH19PKLSqYAevbM="}hA
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"PGID","amt":"999"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"PGID","amt":"27999"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"50000000000"}h!
>j<=:e:0x835ce34470021d428d7afebad46601817084f149:37698898:t:30
text/plain;charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"SATS","amt":"182194794"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"MTMT","amt":"10000"}h!
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841616"}h!
Lu<!DOCTYPE html><script 3197 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3201 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3218 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3213 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"ordi","amt":"2764.5"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
text/html;charset=utf-8
hburialIdxB18ca36f88ad03df2398fc4afd1f71f454261207062e5ddacf16227331ec85e56i0gboneyIdxBf21a36e4e833ca1f00d8928b4d771f48af5469cbd443f3a9a6e1afdf1b5d67f9i0dnamewdigital-turquoise-stoatpminingMultiplier
<!doctype html><html lang="en"><head><meta charset="utf-8"/><link href="/content/1a6e5dca0c78021028ce039409a0f2f40247798b433548e30afba1c498d6e030i0" rel="stylesheet"/><script src="/content/a9f6a9b050af3de1a4ce714978c1f2231ba731f1f46731a16d0e411f89308566i0"></script></head><body><script src="/content/58025710c2bcc8ff006859aa94254c18f5c424504386449522a666a99559ca6ei0" defer="defer"></script></body></html>h!
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3229 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3225 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3231 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3228 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"FSP ","amt":"9100000000000"}h!
Lu<!DOCTYPE html><script 3138 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"800"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"750"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"750"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"750"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"1000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"1000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"750"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"750"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"750"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"750"}h!
Lu<!DOCTYPE html><script 3230 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3234 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
FjD=:ETH.USDT-EC7:0x50f51ccD2B7eCbE8e7b63C816c2C5E0C80d6188F:0/1/0:tr:0
IjG=:ETH.USDT:0xaa6ca0f834006574eef3f7eafa541462142ecde9:357376865500:t:30>
CjA=:ETH.USDC:0xcef3a0431f90c449f4b9e0eb809d5f87d358da1d:0/1/0:dx:10<
FjDOUT:2D2266C09B31D431FABBC69893025E6963C49A9810B9590530C8B7BE3C3A99D4
FjDOUT:46D7ADBA28BA664B25C87DC999E9278FA0204BE070F01FC82FB4389C2050CB48
GjE=:ETH.USDT-EC7:0x4E8566E1007649cD25CDbD477e6807C0bCfa039b:0/1/0:ti:70
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"2000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"1000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"1000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"2000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"1000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"1000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"1000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"2000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"1000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"1000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"1000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"1000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"2000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"1000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"2000"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"2146709000"}h!
FjD=:ETH.DAI-D0F:0xDABf69e2A985a94CbDCA4a258D849e22eE454a7b:0/1/0:ti:70
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5950000000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"68888888888"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"TFER","amt":"10000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"34463731000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"5000"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5950000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"TURT","amt":"73612"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"5098"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"100000000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1000000"}h!
text/plain;charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"BRG2","amt":"100000000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"42200653"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5950000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"3395"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5950000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"slor","amt":"990"}h!
text/plain;charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"rats","amt":"100000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"AMB ","amt":"7000000"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5950000000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"22000000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"corn","amt":"2000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"ordi","amt":"2009.46"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"PGID","amt":"29999"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"PGID","amt":"29999"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5950000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"mice","amt":"23000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"slor","amt":"559.6"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"eorb","amt":"6988"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"TRAC","amt":"2000"}h!
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841617"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"$FMO","amt":"5000"}h!
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3092 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
text/plain;charset=utf-8
C{"p":"brc-20","op":"transfer","tick":"Dovi","amt":"11508.61525153"}h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3211 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3203 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"W
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"W
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"FSP ","amt":"9300000000000"}h!
;[{"p":"brc-20","op":"transfer","tick":"cpos","amt":"3600"}]h!
A{"p":"tap","op":"token-transfer","tick":"DMT-NATEGGS","amt":"25"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"10000000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"10000000"}h!
,j*0x1390ceaa64628f6df4f33198a92430b21141eed4
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"10000000"}h!
1f/Foundry USA Pool #dropgold/2
CjA=:ETH.USDC:0xcef3a0431f90c449f4b9e0eb809d5f87d358da1d:0/1/0:dx:10
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"4999"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"1000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"TX20","amt":"257"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"transfer","tick":"zbit","amt":"4"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
8{"p":"brc-20","op":"transfer","tick":"BTOC","amt":"500"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"2000000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
,j*0x9641D5a025a5d3962815e1A09210a80ff9B9405b
text/plain;charset=utf-8
CjA=:LTC.LTC:ltc1q252rp6tp6e3fpyce05mcf4rwk9522pz36ugtwz:0/1/0:td:70
hbitworkcf0000.1kmint_tickeriperpetualenonce
Lu<!DOCTYPE html><script 3031 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3026 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3079 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3041 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3021 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Bj@=:ETH.ETH:0x370A184dEF7081b3386e794c42dC730A2Fe9803E:0/1/0:td:70
Mined by AntPool1023h
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"2002116000"}h!
FjDOUT:5A18013A5FD6C21EB81632CF80242DCB9F0557E44A2D148FA1300A6489AD52B1
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"slor","amt":"998"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"2000000"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5950000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"2000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"zbit","amt":"500"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"TRIO","amt":"1500"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"2000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"2000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"SIMF","amt":"10000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"2000000"}h!
FjDOUT:460FC247134EE0776F1D2C441D4306D630FBE89C6C2D97539BBE52A262378CE1
text/plain;charset=utf-8
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841618"}h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841619"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"ordi","amt":"6477.6"}h!
Bj@=:BSC.BNB:0x41D40A08C601De3f65ED96ea5E5aB31e77886886:0/1/0:ti:70
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"10000000"}h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
,j*0xf38363749c53a4147cf542380c9e0df0ba5d7527
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"RATS","amt":"4000000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"10000000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"10000000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"10000000"}h!
text/plain;charset=utf-8
LP{"p":"brc-20","op":"transfer","tick":"sats","amt":"9394928708.2466900000000000"}h!
https://devoluwatobi.com
FjDOUT:EE51D21723E62182D6519E656407778E13E1B51B62A7C41054C1EAC24B411297
FjDOUT:407472E5A16804B8E7373F987402EB81C056A20C32A52DC344D7BB15877D648F
:{"p":"brc-20","op":"transfer","tick":"DSWP","amt":"30000"}h!
FjDOUT:40907E909294BB7259D0709A35131A31D82CFC0ABF4F808067C164A0B09DAA14
FjDOUT:F18A3BF42436B28DFC376A5D25F9A069DFF29E2421E64F48F59A4FC1F7EC249B
FjDOUT:68B39D5472D7BF7C2FED15EA52E37A84C40EE6479FE5D2ABB69672E1A7E3A863
FjDOUT:B28C4F665EA86807A0CAE9132AEFDC0AAFCCC6AD910E3E6BBE11FA600276C3CE
FjDOUT:3C8A389BDB7918817D7E3805B5499AD0082B741CF603D26558C3300DF6B4DFED
FjDOUT:D57E49CC0060905E60D0DFE7ED543C1541ABF6D47E1CADD3E9D0E2C08C677ECB
FjDOUT:4130651E5FFFB5D10C1D97D7FB1BE4561339A173631D0EFD6132A331DB9F64ED
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"VMPX","amt":"7720"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"ONFI","amt":"500000"}h!
text/plain;charset=utf-8
D{"p":"brc-20","op":"transfer","tick":"sats","amt":"2632374543.7896"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"ordi","amt":"11"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"mice","amt":"30000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"44444444444"}h!
text/plain;charset=utf-8
I{"p":"brc-20","op":"deploy","tick":"fbtc","max":"21000000","lim":"21000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"BDIN","amt":"30000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"DNCX","amt":"20000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"slor","amt":"990"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"5000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"66666666666"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"4600"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"SIMF","amt":"10000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"55555555555"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5950000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"5000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"5000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1000000"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"5950000000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"ligo","amt":"25000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"5000000"}h!
<j:=:DOGE.DOGE:DU2maJcn72p4ZMTdBAjv6k7Afy374WupXv:0/1/0:ti:70
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841620"}h!
FjD=:ETH.DAI-D0F:0xDABf69e2A985a94CbDCA4a258D849e22eE454a7b:0/1/0:ti:70
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"Tsea","amt":"600"}h!
HjF=:AVAX.USDt-8C7:0xF7088282390A8db323ffCf99D95E922feeF2089c:0/1/0:ti:70
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"trac","amt":"3000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"trac","amt":"3000"}h!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
Lu<!DOCTYPE html><script 3156 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"cats","amt":"400000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"cook","amt":"3000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"ordx","amt":"1000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"Olav","amt":"100"}h!
Bj@=:ETH.ETH:0x970dDe38f52D637361384af8745A1aBFbeC54346:0/1/0:td:70
1f/Foundry USA Pool #dropgold/7
QjLN=:ETH.USDC:0xb118a53693e48d29d3c9891dfdf2745b7bad8cba:16481659613900/3/41:t:30<
GjE=:ETH.USDT-EC7:0x485606Cd12C6d72F682c4b75fEb23d7635f21719:0/1/0:ti:70
FjDOUT:E1EB3E486ABC8C2358E28CFCB2F4C3B93ADF0B580F7938D726F8ECD8A2A997C2
FjDOUT:A5B21D664FEE07BC6F29703E6D8B917E451ABEA61D8DF9BD7925A8A4AB8BB776
FjDOUT:02F706E137E9ACB4749D6AAF01D58BD149D2E4D54F18D7B8945ACAEC6671D025
FjDOUT:EC433DFBE02A668FD152321C175B96A23AFB56868BD002E901D316E657162AD9
FjDOUT:B84AF6E44D198918B6A1E8DE924E78436EC8C9C94755B97E1073E88E448C9C19
FjDOUT:96D6342E8E5D50E05D104E45F57C872AAD83F93956D798FF344F75830DBBB20C
FjDOUT:222B1FDB4A44480B5FCB6E714A66091B80017D73CC5FF85989C4D3439A922D00
FjDOUT:AA53AAF8405A9E13490781A63022DC178E3E119EA74511690908313EE3286889
FjDOUT:C905BCD6E375ACC7C9E524B4CA362DF7FAC9ADAD6A815C3B2FC1B4D3D10048CA
FjDOUT:62CA13286ED6692DF266C6B3C9237F57E4FFAA0B1048155B2778D4673CED4327
CjA=:ETH.USDT-EC7:0xf18B5D66e32a596673B1C237DE94919DB83f30e3:0:ti:70
text/html;charset=utf-8
<script data-s="0xdd06fdfd406bb6eb2245311259a445200f9c286bb723bcf4206bd5cf04acb8e4" src="/content/f80b93466a28c5efc703fab02beebbf4e32e1bc4f063ac27fedfd79ad982f2cei0"></script><body style="display: none"></body>
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"AINN","amt":"5000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"501"}h!
Bj@=:ETH.ETH:0xc593E8042De635C4eA1cfAb6B3c3Bcda4bDba4D5:0/1/0:ti:70
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"cats","amt":"600000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"200"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"sats","amt":"810487756.69"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"pepe","amt":"5000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"1490"}h!
text/html;charset=utf-8
<script data-s="0xfea03c1ff8d298a99e6c771677fe3ee0b6ba6efac57333ca9e4289e2f9997034" src="/content/f80b93466a28c5efc703fab02beebbf4e32e1bc4f063ac27fedfd79ad982f2cei0"></script><body style="display: none"></body>
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"slor","amt":"20000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"TFER","amt":"10512"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"piza","amt":"10000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"2500000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"core","amt":"44888"}h!
GjE=:ETH.USDT-EC7:0xc60df8C52ed6946D78670617B2A8476fC735C6ad:0/1/0:ti:70
@j>=:e:0xf832401ea92a689b0389bc04e25bea891153b040:33717595:oky:30
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"77777777777"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"DFSN","amt":"55"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"SoIa","amt":"22000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DSWP","amt":"5999"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"66666666666"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"66666666666"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"$DOG","amt":"287099110839"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"piin","amt":"20000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"piin","amt":"20000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"piin","amt":"20000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"pepe","amt":"100"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"piin","amt":"20000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"4500"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"piin","amt":"20000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"piin","amt":"20000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"piin","amt":"20000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"piin","amt":"20000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"piin","amt":"20000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"piin","amt":"20000"}h!
IjG=:ETH.USDT:0x0358ac8df709e2701578acef49e517e3171db150:322999562376:t:30
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"piza","amt":"1392"}h!
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"ordi","amt":"2099.2"}h!
Copyright 1999 Adobe Systems Incorporated
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f5919346e6cb54a1374e4bf831bd907cd337139f4c7b875e40ab95747a13d202","iid":"early collectors pass","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":29,"minter":"bc1px08v8v5d78aj7f6e9zw4dhz9edg4lflhdg245meh7g44aq6l7tyqlzwkxc","sig":"HIx7ThMSk0nL9LhhEE6uXGUywT0bsO8GfSQkRyQUQ3ZAKPJymlGVB9Ler0Tr7+Sl+oBxwJ8T4bqghMPN6P0Aac0="}hA
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841621"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
Lu<!DOCTYPE html><script 3232 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3210 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
,j*0x06e377979b29be08096128023c00cc240a191d7d
text/plain;charset=utf-8
{"p":"lam","op":"multi","calls":[{"contract":"dep:dmt:RAMBO","function":"mint","args":[]},{"contract":"dep:dmt:LAMBO","function":"mint","args":[]},{"contract":"dep:dmt:FIRST","function":"mint","args":[]},{"contract":"dep:dmt:LAMB","function":"mint","args":[]},{"contract":"dep:dmt:LAMBADA","function":"mint","args":[]},{"contract":"dep:dmt:SHAKES","function":"mint","args":[]},{"contract":"dep:dmt:GME","function":"mint","args":[]},{"contract":"dep:dmt:COCC","function":"mint","args":[]},{"contract":"dep:dmt:OXBT","func
tion":"mint","args":[]}]}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"TX20","amt":"400"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"TX20","amt":"401"}h!
text/plain;charset=utf-8
Lu<!DOCTYPE html><script 3243 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"Tsea","amt":"600"}h!
,j*0xfdb414b7ecfeeae965b4a46d7e38f1117f391471
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"4000000"}h!
2f/Foundry USA Pool #dropgold/C
Bj@=:ETH.ETH:0x1eEf91b7Db2848A528A0762B0C5327A53B2EadBe:0/1/0:td:70
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"ordi","amt":"3998.4"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"ordi","amt":"1999.2"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"ordi","amt":"632.2"}h!
?j==:e:0x0757669F25312F9B68B2cf7840A146d774bBA134:231230617:t:30
@j>=:THOR.RUNE:thor1e27l6tw78yggq62pg0nl625y87rysjsmtdhhjn::wr:30
GjE=:ETH.USDT-EC7:0x0577f305C44b4E9e3abe806Cd5b0C2e514279285:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0x7eb6382254b16A8d7c0ff61A4E4Fc6daC1364aaf:0/1/0:ti:70
FjDOUT:2E7345796E6926BF85E1F353A8AA6EDCB7096E1321DAF7327E7BC0E99BF67C9B
FjDOUT:665EDAD34259D166CE0E1941AC473FE51C476A217194BC2DF96DDBABD5BC3797
FjDOUT:E86854CA6E8D51A3DFC2EABE8845D818139E7C6D0F14AD3B17CCE0AE1ECAA912
FjDOUT:0FA5EC496F3AB913C6D136EADB69B1F73A4799CAED867F31F12FA83B4A2638B7
FjDOUT:FAEA20F0CC535B01AAE6E7EA390DBD19F4B2930F47F5F83B7A43F238937A2739
Bj@=:ETH.ETH:0xcdB440B09d6D09AB00b4e82F8dD639182441ed4A:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0x7d86bae0955507A4e88a40cd25554122B6d06D43:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0x8F178623e3B8E08a4C7c67A2d8C5AE29Eaccfaf7:0/1/0:ti:70
Bj@=:ETH.ETH:0x0cb1dC00AdECd9104C977B3764A008C568E4e7b2:0/1/0:ti:70
text/plain;charset=utf-8
6{"p":"brc-20","op":"transfer","tick":"PUPS","amt":"5"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"55555555555"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"540"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"slor","amt":"990"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"aoas","amt":"1200"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"BTZF","amt":"7180000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"4999"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"PGID","amt":"1500"}h!
""""""""""""""""""""""""""""""""S
GjE=:ETH.USDT-EC7:0xBa3F4D7901973F9B3332E3a26d7b8BAB81cF7D60:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0x1a97AB8FffFDbaecf173Ed615A7780D11bD927Cd:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0xc60df8C52ed6946D78670617B2A8476fC735C6ad:0/1/0:ti:70
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"MMSS","amt":"3876.25"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"89495066393"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"mice","amt":"98670.7034"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"5100"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"Mirac","amt":"800000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"aoas","amt":"700"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"5000"}h!
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"eorb","amt":"63560"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"transfer","tick":"rebt","amt":"0"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"SIMF","amt":"10000"}h!
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"1000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"1008"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"HLVN","amt":"18750"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"BTZF","amt":"7180000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"TDTB","amt":"100000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"100000000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"BTZF","amt":"7180000"}h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841622"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"pepe","amt":"7900"}h!
Lu<!DOCTYPE html><script 3187 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3204 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3192 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"piin","amt":"10000000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"100000000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"FCDP","amt":"9.4"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"fbtc","amt":"21000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"5000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"xDAO","amt":"2000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"TFER","amt":"186000"}h!
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"ordi","amt":"1100.64405064"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"DNCX","amt":"300000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"PUPS","amt":"250"}h!
Lu<!DOCTYPE html><script 3238 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"roup","amt":"288530.888"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"roup","amt":"288530.888"}h!
Lu<!DOCTYPE html><script 3249 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"rats","amt":"400000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"slor","amt":"990"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"meme","amt":"10.65"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"meme","amt":"10.76"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"meme","amt":"10.97"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"meme","amt":"11.2"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"SHNT","amt":"1000"}h!
text/plain;charset=utf-8
{"p":"lam","op":"multi","calls":[{"contract":"dep:dmt:RAMBO","function":"mint","args":[]},{"contract":"dep:dmt:LAMBO","function":"mint","args":[]},{"contract":"dep:dmt:FIRST","function":"mint","args":[]},{"contract":"dep:dmt:LAMB","function":"mint","args":[]},{"contract":"dep:dmt:LAMBADA","function":"mint","args":[]},{"contract":"dep:dmt:SHAKES","function":"mint","args":[]},{"contract":"dep:dmt:GME","function":"mint","args":[]},{"contract":"dep:dmt:COCC","function":"mint","args":[]},{"contract":"dep:dmt:OXBT","func
tion":"mint","args":[]}]}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"SHNT","amt":"1000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"meme","amt":"11.08"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"rcsv","amt":"10000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"meme","amt":"10.87"}h!
text/html;charset=utf-8
hburialIdxB3c4297a47d4215223cf408cc16d356b6d40477ad8febba218e6a317377ae1b91i0gboneyIdxB46d74f4bc9e0c9e18dea5f8bd19baa1ce38c5381c5d357870af88f10fd2229f3i0dnameqill-salmon-grousepminingMultiplier
<!doctype html><html lang="en"><head><meta charset="utf-8"/><link href="/content/1a6e5dca0c78021028ce039409a0f2f40247798b433548e30afba1c498d6e030i0" rel="stylesheet"/><script src="/content/a9f6a9b050af3de1a4ce714978c1f2231ba731f1f46731a16d0e411f89308566i0"></script></head><body><script src="/content/58025710c2bcc8ff006859aa94254c18f5c424504386449522a666a99559ca6ei0" defer="defer"></script></body></html>h!
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3220 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
2f/Foundry USA Pool #dropgold/&*wb
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"trac","amt":"643"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"piza","amt":"723"}h!
GjE=:ETH.USDT-EC7:0x79aaC1a03a6E98bDB8EA62F882ce4349505916A6:0/1/0:ti:70
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"67058806920"}h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841623"}h!
Lu<!DOCTYPE html><script 3224 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"31700000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"1550"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"5300"}h!
Lu<!DOCTYPE html><script 3244 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3245 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"aisi","amt":"14776"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"base","amt":"100000"}h!
Lu<!DOCTYPE html><script 3217 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3246 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3242 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3250 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3260 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3183 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"tron","amt":"10000000"}h!
text/html;charset=utf-8
  <meta charset="UTF-8" />
  <meta name="viewport" content="width=device-width, initial-scale=1.0" />
  <title>OPTIMISM</title>
      background-color: black;
      position: relative;
      overflow: hidden;
      aspect-ratio: 1 / 1;
      position: fixed;
      max-width: 1000px;
      filter: contrast(103%);
      margin: 0 !important;
      position: fixed;
      max-width: 995px;
      aspect-ratio: 1 / .99;
      animation: oscillateHue 3600s infinite alternate;
    @keyframes oscillateHue {
        filter: hue-rotate(230deg) saturate(70%) contrast(150%);
        filter: hue-rotate(350deg) saturate(70%) contrast(150%);
        filter: hue-rotate(230deg) saturate(70%) contrast(150%);
  <div id="container">
    <img id="top-asset" src="/content/54242fd3c063f6fff69b762ce15e60faa4a889bd3caafaa7d085ebd443864a0ci0" />
    <iframe id="iframe" src="/content/5a1e991817e0bcaa2147872cde63b2b6bf19c1b0d0cff4625acd09631a9cc35ci0"></iframe>
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"PUPS","amt":"100"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"OXBT","amt":"12500"}h!
8{"p":"brc-20","op":"transfer","tick":"ORDI","amt":"100"}h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3202 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3258 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3226 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3233 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"1183333"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"Amok","amt":"10000"}h!
text/plain;charset=utf-8
LR{"op":"minting-claim","p":"orc-20","params":{"amt":"2520","tick":"poi","tid":"1"}}h!
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3262 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3254 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3257 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3236 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3223 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/html;charset=utf-8
<script data-s="0x00e296c38ff70880b66f49fb1da7a74267b0585ea134684c50aa5d8ed22b7493" src="/content/f80b93466a28c5efc703fab02beebbf4e32e1bc4f063ac27fedfd79ad982f2cei0"></script><body style="display: none"></body>
Lu<!DOCTYPE html><script 3173 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
CjA=:ETH.ETH:0x85ad0d866f7c54e1b279dab76b98103d84fb6586:0/9/12:wr:30
<j:=:e:0xd61b1db35ce8c794d174997e63a0dc76d51e1e32:0/1/0:dx:10
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","amt":"1999.2","tick":"ordi"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","amt":"1305174508","tick":"sats"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"ordi","amt":"44.47"}h!
text/plain;charset=utf-8
LN{"p":"brc-20","op":"transfer","tick":"rats","amt":"49900692.0000000000000000"}h!
GjE=:ETH.USDT-EC7:0x4422A21f4A64545B01D3fA5B5128D53A0Ec45047:0/1/0:ti:70
FjDOUT:1F1BCBB7B31BC05E070753506E5D0BC5867B0C864F5FD9F57E9EBFA95B170FA1
FjDOUT:41D33A43F27F52B6D90877CC2C4ED36A29D02C3EB58CDD11C1DC8B8748F23846
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"Mirac","amt":"800000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"5000"}h!
,j*0x97583924a0d61a03bc4a5d1adcad23942fa205b0,
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"VSAD","amt":"2500"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"sats","amt":"732929475000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"sxio","amt":"2500"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"24950000000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"ONFI","amt":"500000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"rcsv","amt":"10000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"2290"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"slor","amt":"10000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"slor","amt":"998"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"TFER","amt":"262000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"aoas","amt":"1000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"BTZF","amt":"3540000"}h!
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"Sqts","amt":"1000000000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"PGID","amt":"31999"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"200000000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"merm","amt":"3000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"BTZF","amt":"7180000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"TURT","amt":"399500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"aoas","amt":"500"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"BTZF","amt":"7180000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"55555555555"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"aoas","amt":"1000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"1000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"66666666666"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"77777777777"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"PUPS","amt":"250"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"PGID","amt":"31999"}h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841624"}h!
CjA=:LTC.LTC:ltc1qltrlpsyyxsfsyc9677fh2rwfn5a4rddspvvpum:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0xdbe4A7058AcdA80a1FD3EB8204c7e3F15e3b97DB:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0x65063fa34f0800062226E5540cB370877D811982:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0x9c752CC28bF820e065BC1a9CBa47489773b8AcB0:0/1/0:ti:70
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3140 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
Lu<!DOCTYPE html><script 3253 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
,j*0x67607FFDB3446d3E92649da58a20424503845596
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"xDAO","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"xDAO","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"weth","amt":"5000"}h!
,j*0xc99bbe86127857e1898a9461c6620098eccf3338
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"aisi","amt":"10000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"250"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"xDAO","amt":"500"}h!
text/plain;charset=utf-8
LP{"p":"brc-20","op":"deploy","tick":"aeme","lim":"8100000000","max":"8100000000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"Oshi","amt":"10"}h!
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3267 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3261 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
<j:=:e:0xd61b1db35ce8c794d174997e63a0dc76d51e1e32:0/1/1:dx:10
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"1269081418"}h!
FjDOUT:C8444C38A575ECFB1C2A0865233D1A6C782A41D1CE6EF3D5A9E4954B76BFACFD
FjDOUT:00DEBF7C545E4E10A7B05E40EAFA7EFD85A18C683E7E39B0EE1AE20F0A324900
FjDOUT:C02F58557E471109EA74EECFC9E9C0DB9EB6050EF0AE90050310B1D0067F25F3
FjDOUT:D014500AE5662E9712EDD9FC6A1F0EDFFC76E035A1CB06FBD3D61EE3213DE0A9
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"666666"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1000000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"666666"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"666666"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"666666"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"666666"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"666666"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"PGID","amt":"8000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"666666"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"666666"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1000000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"YQzz","amt":"20579794200"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"30000000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"666666"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"666666"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1000000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"RSK ","amt":"100000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"Pika","amt":"30000"}h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841625"}h!
text/plain;charset=utf-8
C{"p":"brc-20","op":"transfer","tick":"sats","amt":"91973429119.71"}h!
Lu<!DOCTYPE html><script 3266 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"1999.999"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"piza","amt":"1800"}h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
,j*0x43f50a3D02c9455587a1cb638085B34930E787Ca
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"4000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"4000000"}h!
text/plain;charset=utf-8
LR{"op":"minting-claim","p":"orc-20","params":{"amt":"2520","tick":"poi","tid":"1"}}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"TX20","amt":"403"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"4000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"4000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"4000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"4000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"4000000"}h!
,j*0xd60e5e9d3adfa4b3e1b53fb4908feec128365395
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"4000000"}h!
text/html;charset=utf-8
jbackgroundilost landdbodyhgelatinegclothesfwizarddnoseccutemouthfgeishadeyeseseweddheadicyberpunkdhandhgelatineditemhchainsaw
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i116",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i1",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i31",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i32",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i54",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i62",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i82",
       Lx "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi6"]
text/html;charset=utf-8
jbackgroundncyberpunk citydbodyeblackgclothesnnative ordinaldnosefbuttonemouthesmiledeyesfhackerdheadcfoxdhandeblackditembPP
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i111",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i23",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi1",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i47",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i63",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        "Lw/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i91"]
text/html;charset=utf-8
jbackgroundibeeyoselfdbodyfrottengclothesnnative ordinaldnoseesmallemoutheseweddeyesgcuriousdheadlunsuccessfuldhandfrottenditemdrune
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i108",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i23",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i44",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i76",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
       Lz "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i102"]
text/html;charset=utf-8
jbackgroundfforestdbodyhturkoisegclothesnnative ordinaldnoseccutemouthehappydeyescsaddheadewhitedhandhturkoiseditemgBTC mag
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i112",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i23",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i53",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i78",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i88"]
text/html;charset=utf-8
jbackgroundkfuture citydbodyhturkoisegclothesfkimonodnosedcuteemouthehappydeyescsaddheaddgreydhandhturkoiseditemerazia
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i113",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i20",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i53",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i65",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
       Lz "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i101"]
text/html;charset=utf-8
jbackgroundfforestdbodyfrottengclothesmbounty hunterdnosedtallemouthehappydeyesfhackerdheadewhitedhandfrottenditemcXMR
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i112",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i15",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i47",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i78",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i92"]
text/html;charset=utf-8
jbackgrounddmtrxdbodyegreengclothesjBTC kimonodnosehbleedingemouthcsaddeyesgcuriousdhandegreenditemcXMR
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i118",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i2",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i8",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i44",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i83",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i92"]
text/html;charset=utf-8
jbackgroundkhackerspacedbodydpinkgclotheslunsuccessfuldnoseesmallemouthcsaddeyeskdropped eyedheadfpiratedhanddpinkditemhchainsaw
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i115",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i30",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i46",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i72",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i84",
       Lx "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi6"]
text/html;charset=utf-8
jbackgroundispaceshipdbodyfrottengclothesfartistdnosedcuteemoutheseweddeyeselaserdheaderamendhandfrottenditemgBTC mag
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i119",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i14",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i50",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i73",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i88"]
text/html;charset=utf-8
jbackgroundcCLIdbodyegreengclothesnnative ordinaldnosedtallemouthesmiledeyesfhackerdheaderamendhandegreenditemdstar
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i110",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i2",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i23",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i47",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i73",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i83",
       Ly "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi12"]
text/html;charset=utf-8
jbackgroundhmountaindbodyhskeletongclothesinurturingdnoseccutemouthesmiledeyeshBTC lookdheadlunsuccessfuldhandhskeletonditemgBTC mag
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i117",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i5",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i25",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i42",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i76",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i86",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i88"]
text/html;charset=utf-8
jbackgroundfforestdbodyhgelatinegclothesfwizarddnoseccutemoutheseweddeyeskbrainwasheddheaddphatdhandhgelatineditemfshroom
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i112",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i1",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i31",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i43",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i71",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i82",
       Ly "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi11"]
text/html;charset=utf-8
jbackgroundgwindowsdbodyegreengclotheshhawaiiandnosedcuteemouthcsaddeyeseseweddheadglab petdhandegreenditemeSigma
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i121",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i2",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i19",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i54",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i67",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i83",
       Lx "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi4"]
text/html;charset=utf-8
jbackgroundgwindowsdbodyhturkoisegclothesjBTC kimonodnoseccutemouthgwhistledeyesjlaser 9000dheadcfoxdhandhturkoiseditemeflame
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i121",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i8",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i37",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i63",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i49",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
        Lw"/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi7"]
text/html;charset=utf-8
jbackgrounddmtrxdbodyhgelatinegclotheslunsuccessfuldnosefbuttonemouthgwhistledeyeskdropped eyedheadmbounty hunterdhandhgelatineditemelotus
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i118",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i1",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i30",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi1",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i37",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i46",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i59",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i82",
        Lw"/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi8"]
text/html;charset=utf-8
jbackgroundkpsychedelicdbodyfrottengclothesiPP hoodiednosefbuttonemoutheseweddeyeskbrainwasheddheaddnestdhandfrottenditemcZTG
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi15",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
t/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i11",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi1",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i43",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i70",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
        "Lw/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i93"]
text/html;charset=utf-8
jbackgroundgCLI devdbodyegreengclothesjBTC piratednosedtallemoutheseweddeyescsaddheadewhitedhandegreenditemeflame
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i109",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i2",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i9",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i53",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i78",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i83",
        Lw"/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi7"]
text/html;charset=utf-8
jbackgroundkfuture citydbodyhgelatinegclothesfartistdnosedtallemoutheseweddeyesfhollowdheaderamendhandhgelatineditemeflame
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i113",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i1",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i14",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i48",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i73",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i82",
       Lx "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi7"]
text/html;charset=utf-8
jbackgroundncyberpunk citydbodyhturkoisednosedcuteemouthesmiledeyeshBTC lookdheadfgeishadhandhturkoiseditemfpoison
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i111",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i42",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i64",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi10"]
text/html;charset=utf-8
jbackgroundhmountaindbodydpinkgclothesfwizarddnosehbleedingemouthesmiledeyesgcuriousdheadewhitedhanddpinkditemfpoison
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i117",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i31",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i44",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i78",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i84",
        Lx"/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi10"]
text/html;charset=utf-8
jbackgroundibeeyoselfdbodyhturkoisegclotheslunsuccessfuldnosedcuteemouthfgeishadeyesjlaser 9000dhandhturkoiseditemepizza
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i108",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i30",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i32",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i49",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i100"]
text/html;charset=utf-8
jbackgroundispaceshipdbodyhturkoisednoseccutemouthcsaddeyesgcuriousdheadnBTC headphonesdhandhturkoiseditemcETH
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i119",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i44",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i56",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i90"]
text/html;charset=utf-8
jbackgroundispaceshipdbodyegreengclothesrpsychedelic tshirtdnosedcuteemouthehappydeyeselaserdheaderamendhandegreenditemdrune
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i119",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i2",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i28",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i50",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i73",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i83",
       Lz "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i102"]
text/html;charset=utf-8
jbackgroundncyberpunk citydbodyfrottengclotheseninjadnosefbuttonemoutheseweddeyesgmissingdheaddphatdhandfrottenditemilaser gun
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i111",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i24",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi1",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i51",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i71",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
        Lx"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i98"]
text/html;charset=utf-8
jbackgroundispaceshipdbodyhturkoisednoseesmallemoutheseweddeyeskbrainwasheddheadfminingdhandhturkoiseditemdstar
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i119",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i43",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i69",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi12"]
text/html;charset=utf-8
jbackgroundfforestdbodydpinkgclothesjBTC bikinidnosedcuteemouthcsaddeyesfhollowdheaddvotedhanddboneditemcXMR
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i112",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i7",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i48",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i77",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i81",
        Lx"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i92"]
text/html;charset=utf-8
jbackgroundgCLI devdbodyfrottengclothesfkimonodnosefbuttonemoutheseweddeyeshBTC lookdheadgclassicdhandfrottenditemilaser gun
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i109",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i20",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi1",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i42",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i60",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
        Lx"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i98"]
text/html;charset=utf-8
jbackgroundgwindowsdbodyhturkoisegclothesfartistdnoseccutemouthgwhistledeyeshBTC lookdheadfgeishadhandhturkoiseditemerazia
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i121",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i14",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i37",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i42",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i64",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
       Lz "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i101"]
text/html;charset=utf-8
jbackgroundibeeyoselfdbodydpinkgclothesclabdnoseesmallemoutheseweddeyeskbrainwasheddheaderamendhanddboneditemcXMR
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i108",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i21",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i43",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i73",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i81",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i92"]
text/html;charset=utf-8
jbackgroundjBTC portaldbodydpinkgclothesicyberpunkdnosedcuteemouthesmiledeyeslunsuccessfuldheadgclassicdhanddboneditemjdoubleshot
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i107",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i17",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i55",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i60",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i81",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i95"]
text/html;charset=utf-8
jbackgroundkfuture citydbodyeblackgclotheslunsuccessfuldnosefbuttonemouthesmiledeyeslunsuccessfuldheadgclassicdhandeblackditemilaser gun
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i113",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i30",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi1",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i55",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i60",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        "Lw/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i98"]
text/html;charset=utf-8
jbackgroundjBTC portaldbodyfrottengclotheshexplorerdnoseccutemoutheseweddeyesdmtrxdheaddphatdhandfrottenditemgBTC mag
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i107",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i18",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i52",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i71",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i88"]
text/html;charset=utf-8
jbackgroundhgraffitidbodyhgelatinegclothesfteareddnoseccutemoutheseweddeyeshBTC lookdheadkanonym maskdhandhgelatineditemelotus
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i114",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i1",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i29",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i42",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i57",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i82",
       Lx "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi8"]
text/html;charset=utf-8
jbackgroundibeeyoselfdbodyhturkoisegclothesiPP tshirtdnosehbleedingemoutheseweddeyesfhollowdhandhturkoiseditemepizza
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i108",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i12",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i48",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i100"]
text/html;charset=utf-8
jbackgroundkpsychedelicdbodyeblackgclothesjBTC bikinidnosehbleedingemouthehappydeyeslunsuccessfuldheadimagic catdhandeblackditemfshroom
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi15",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
t/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i7",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i55",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i68",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        "/cLuontent/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi11"]
text/html;charset=utf-8
jbackgroundgwindowsdbodyhturkoisednoseesmallemouthcsaddeyesdmtrxdheaddphatdhandhturkoiseditemfledger
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i121",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i52",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i71",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i99"]
text/html;charset=utf-8
jbackgroundkhackerspacedbodyhskeletongclotheslunsuccessfuldnosedtallemoutheseweddeyescsaddheadglab petdhandhskeletonditemgBTC mag
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i115",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i5",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i30",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i53",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i67",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i86",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i88"]
text/html;charset=utf-8
jbackgroundczbrdbodydpinkdnosedtallemouthgwhistledeyeshBTC lookdheadicyberpunkdhanddboneditemeflame
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i122",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i37",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i42",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i62",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i81",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi7"]
text/html;charset=utf-8
jbackgroundkpsychedelicdbodyeblackgclothesjBTC tshirtdnosedcuteemoutheseweddeyeskbrainwasheddheadfpiratedhandeblackditemcXMR
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi15",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
t/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i10",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i43",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i72",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        "Lw/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i92"]
text/html;charset=utf-8
jbackgroundispaceshipdbodyhturkoisegclotheselatexdnosefbuttonemouthesmiledeyeskdropped eyedheaddgreydhandhturkoiseditemcETH
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i119",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i22",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi1",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i46",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i65",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
        Lx"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i90"]
text/html;charset=utf-8
jbackgroundkhackerspacedbodyegreengclothesfartistdnosedtallemouthehappydeyeskbrainwasheddheaddnestdhandegreenditemlhungry plant
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i115",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i2",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i14",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i43",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i70",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i83",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i97"]
text/html;charset=utf-8
jbackgroundncyberpunk citydbodydpinkgclothesearmordnosefbuttonemouthgwhistledeyeselaserdheaddgreydhanddboneditemdrune
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i111",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i13",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi1",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i37",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i50",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i65",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i81",
        Ly"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i102"]
text/html;charset=utf-8
jbackgroundibeeyoselfdbodydpinkgclotheslorange aprondnosedtallemouthehappydeyesdmtrxdheaddphatdhanddboneditemcBTC
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i108",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i26",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i52",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i71",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i81",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i89"]
text/html;charset=utf-8
jbackgroundispaceshipdbodyfrottengclothesjBTC tshirtdnoseesmallemouthesmiledeyeslunsuccessfuldheadkanonym maskdhandfrottenditemcBTC
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i119",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i10",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i55",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i57",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i89"]
text/html;charset=utf-8
jbackgroundilost landdbodyegreengclotheshhawaiiandnosedtallemouthehappydeyesfhollowdheadescarfdhandegreenditemfledger
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i116",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i2",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i19",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i48",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i74",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i83",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i99"]
text/html;charset=utf-8
jbackgroundkpsychedelicdbodyhgelatinegclothesjBTC bikinidnosehbleedingemouthehappydeyeselaserdheadcspydhandhgelatineditemgyinyang
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi15",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i1",
t/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i7",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i50",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i75",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i82",
        "/Lwcontent/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i104"]
text/html;charset=utf-8
jbackgroundfforestdbodyegreengclotheshhawaiiandnosefbuttonemouthcsaddeyesicyberpunkdheadimagic catdhandegreenditemfpoison
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i112",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i2",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i19",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi1",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i45",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i68",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i83",
        Lx"/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi10"]
text/html;charset=utf-8
jbackgroundjBTC portaldbodydpinkgclothesrpsychedelic tshirtdnoseesmallemoutheseweddeyesgmissingdhanddpinkditemfhacker
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i107",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i28",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i51",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i84",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i96"]
text/html;charset=utf-8
jbackgroundgCLI devdbodyeblackdnoseccutemoutheseweddeyeslunsuccessfuldheadicyberpunkdhandeblackditemepizza
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i109",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i55",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i62",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i100"]
text/html;charset=utf-8
jbackgroundczbrdbodyhskeletondnosehbleedingemouthcsaddeyesgmissingdheadfminingdhandhskeletonditemjdoubleshot
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i122",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i5",
nt/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i51",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i69",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i86",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i95"]
text/html;charset=utf-8
jbackgroundncyberpunk citydbodyfrottengclothesicyberpunkdnoseesmallemouthehappydeyesfhackerdheadkanonym maskdhandfrottenditemdrune
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i111",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i17",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i47",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i57",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
       Lz "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i102"]
text/html;charset=utf-8
jbackgroundispaceshipdbodyhgelatinegclothesiPP hoodiednoseccutemoutheseweddeyeseseweddheadgclassicdhandhgelatineditemdstar
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i119",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i1",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i11",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i54",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i60",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i82",
       Ly "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi12"]
text/html;charset=utf-8
jbackgroundkfuture citydbodyhturkoisednosedtallemouthfgeishadeyeskbrainwasheddheadglab petdhandhturkoiseditemgZ heart
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i113",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i32",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i43",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i67",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi5"]
text/html;charset=utf-8
jbackgroundfforestdbodydpinkgclotheshexplorerdnosehbleedingemouthgwhistledeyescsaddheadbVRdhanddpinkditemhchainsaw
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i112",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i18",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i37",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i53",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi2",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i84",
        "Lv/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi6"]
text/html;charset=utf-8
jbackgroundkhackerspacedbodyhturkoisegclothesfwizarddnosedcuteemouthehappydeyesfhackerdheadfminingdhandhturkoiseditemcZTG
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i115",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i31",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i47",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i69",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i93"]
text/html;charset=utf-8
jbackgroundkpsychedelicdbodyegreengclothesfkimonodnosefbuttonemouthehappydeyeshBTC lookdhandegreenditemjdoubleshot
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi15",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i2",
t/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i20",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi1",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i42",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i83",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i95"]
text/html;charset=utf-8
jbackgroundgCLI devdbodyfrottengclothesrpsychedelic tshirtdnosefbuttonemoutheseweddeyeskdropped eyedheadgclassicdhandfrottenditemerazia
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i109",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i28",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi1",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i46",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i60",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
        Ly"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i101"]
text/html;charset=utf-8
jbackgroundhgraffitidbodyeblackgclothesclabdnoseesmallemouthesmiledeyesfhackerdheadlunsuccessfuldhandeblackditemfpoison
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i114",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i21",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i47",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i76",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        Lx"/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi10"]
text/html;charset=utf-8
jbackgroundhmountaindbodyeblackgclotheseninjadnoseesmallemouthgwhistledeyesfhackerdheadgclassicdhandeblackditemepizza
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i117",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i24",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i37",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i47",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i60",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        Ly"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i100"]
text/html;charset=utf-8
jbackgroundjBTC portaldbodydpinkgclothesppost apocalypticdnoseccutemouthgwhistledeyeskdropped eyedheaddwolfdhanddboneditemcBTC
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i107",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i27",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i37",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i46",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i80",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i81",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i89"]
text/html;charset=utf-8
jbackgroundkfuture citydbodyhskeletongclotheseninjadnosehbleedingemouthfgeishadeyeseseweddheadescarfdhandhskeletonditemfshroom
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i113",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i5",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i24",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i32",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i54",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i74",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i86",
        Lx"/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi11"]
text/html;charset=utf-8
jbackgroundncyberpunk citydbodyfrottengclothesinurturingdnoseesmallemoutheseweddeyeshBTC lookdhandfrottenditemilaser gun
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i111",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i25",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i42",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i98"]
text/html;charset=utf-8
jbackgroundilost landdbodyfrottengclothesfkimonodnoseesmallemouthesmiledeyeshBTC lookdheadnBTC headphonesdhandfrottenditemhchainsaw
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i116",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i20",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i42",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i56",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
       Lx "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi6"]
text/html;charset=utf-8
jbackgroundgwindowsdbodyeblackgclothesjBTC kimonodnosefbuttonemouthehappydeyesgmissingdheadbVRdhandeblackditemjdoubleshot
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i121",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i8",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi1",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i51",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi2",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        "/cLuontent/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i95"]
text/html;charset=utf-8
jbackgroundcCLIdbodyegreengclotheseninjadnosedtallemouthehappydeyesdmtrxdheaddvotedhandegreenditemdrune
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i110",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i2",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i24",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i52",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i77",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i83",
       Lz "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i102"]
text/html;charset=utf-8
jbackgroundjBTC portaldbodyhskeletongclotheselatexdnosedtallemouthgwhistledeyeslunsuccessfuldheadgclassicdhandhskeletonditemfshroom
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i107",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i5",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i22",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i37",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i55",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i60",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i86",
       Ly "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi11"]
text/html;charset=utf-8
jbackgroundetraindbodydpinkgclotheshexplorerdnoseesmallemouthesmiledeyeseseweddheadfpiratedhanddboneditemhchainsaw
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i120",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i18",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i54",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i72",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i81",
       Lx "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi6"]
text/html;charset=utf-8
jbackgroundkhackerspacedbodyegreengclotheselatexdnosehbleedingemouthcsaddeyescsaddheadcfoxdhandegreenditembPP
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i115",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i2",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i22",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i53",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i63",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i83",
        Lx"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i91"]
text/html;charset=utf-8
jbackgroundcCLIdbodyeblackdnoseccutemoutheseweddeyescsaddheadfwizarddhandeblackditemfshroom
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i110",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i53",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i79",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi11"]
text/html;charset=utf-8
jbackgroundkpsychedelicdbodyhturkoisegclotheselatexdnosefbuttonemoutheseweddeyesgmissingdheadcfoxdhandhturkoiseditemeflame
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi15",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
t/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i22",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi1",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i51",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i63",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
        "Lv/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi7"]
text/html;charset=utf-8
jbackgroundkhackerspacedbodyfrottengclothesppost apocalypticdnosefbuttonemouthesmiledeyesgmissingdheadglab petdhandfrottenditemeflame
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i115",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i27",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi1",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i51",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i67",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
        Lw"/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi7"]
text/html;charset=utf-8
jbackgroundjBTC portaldbodyeblackgclothesfartistdnosedcuteemouthcsaddeyesgmissingdheadeblackdhandeblackditembPP
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i107",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i14",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i51",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i58",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        Lx"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i91"]
text/html;charset=utf-8
jbackgroundgCLI devdbodyhturkoisegclothesjBTC piratednosedtallemouthfgeishadeyeslunsuccessfuldheadkanonym maskdhandhturkoiseditemfpoison
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i109",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i9",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i32",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i55",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i57",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
        Lx"/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi10"]
text/html;charset=utf-8
jbackgroundjBTC portaldbodyhskeletongclotheshexplorerdnosefbuttonemouthcsaddeyesdmtrxdheadicyberpunkdhandhskeletonditemerazia
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i107",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i5",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i18",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi1",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i52",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i62",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i86",
        Ly"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i101"]
text/html;charset=utf-8
jbackgroundgwindowsdbodyhturkoisegclothesnnative ordinaldnoseesmallemouthcsaddeyesicyberpunkdheadescarfdhandhturkoiseditemjdoubleshot
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i121",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i23",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i45",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i74",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i95"]
text/html;charset=utf-8
jbackgroundncyberpunk citydbodyeblackgclothesiPP hoodiednosedcuteemouthcsaddeyesdmtrxdheadeblackdhandeblackditemerazia
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i111",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i11",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i52",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i58",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        Ly"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i101"]
text/html;charset=utf-8
jbackgroundgCLI devdbodyhgelatinegclothesppost apocalypticdnosehbleedingemoutheseweddeyesicyberpunkdheaddphatdhandhgelatineditemepizza
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i109",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i1",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i27",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i45",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i71",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i82",
        Ly"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i100"]
text/html;charset=utf-8
jbackgroundcCLIdbodyfrottengclothesjBTC piratednoseccutemouthcsaddeyescsaddheadlunsuccessfuldhandfrottenditemdstar
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i110",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i9",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i53",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i76",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
        Lx"/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi12"]
text/html;charset=utf-8
jbackgroundhgraffitidbodydpinkgclothesjBTC tshirtdnoseesmallemouthcsaddeyesgcuriousdheadnBTC headphonesdhanddpinkditemcBTC
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i114",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i10",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i44",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i56",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i84",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i89"]
text/html;charset=utf-8
jbackgroundcCLIdbodydpinkgclothesfartistdnoseesmallemoutheseweddeyesgcuriousdhanddboneditemilaser gun
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i110",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i14",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i44",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i81",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i98"]
text/html;charset=utf-8
jbackgroundhmountaindbodyfrottengclothesjBTC kimonodnoseesmallemoutheseweddeyesfhollowdheadgclassicdhandfrottenditemfhacker
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i117",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i8",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i48",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i60",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
        Lx"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i96"]
text/html;charset=utf-8
jbackgroundkhackerspacedbodydpinkgclotheshexplorerdnosefbuttonemouthesmiledeyeskdropped eyedheadbVRdhanddboneditemcorb
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i115",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i18",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi1",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i46",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi2",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i81",
        "Lw/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi13"]
text/html;charset=utf-8
jbackgroundetraindbodyeblackgclothesnnative ordinaldnosehbleedingemouthcsaddeyeskdropped eyedheaddgreydhandeblackditemfledger
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i120",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i23",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i46",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i65",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        "Lw/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i99"]
text/html;charset=utf-8
jbackgroundetraindbodydpinkgclotheshexplorerdnosedtallemouthesmiledeyesjlaser 9000dheadcfoxdhanddpinkditemelotus
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i120",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i18",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i63",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i49",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i84",
       Lx "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi8"]
text/html;charset=utf-8
jbackgroundczbrdbodyeblackgclothesiPP hoodiednosehbleedingemouthgwhistledeyesjlaser 9000dheadfminingdhandeblackditemcBTC
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i122",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i11",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i37",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i69",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i49",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        "Lw/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i89"]
text/html;charset=utf-8
jbackgroundispaceshipdbodyegreengclothesfteareddnosedtallemouthfgeishadeyescsaddheadicyberpunkdhandegreenditemcXMR
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i119",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i2",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i29",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i32",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i53",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i62",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i83",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i92"]
text/html;charset=utf-8
jbackgroundetraindbodyhgelatinegclothesjBTC bikinidnoseesmallemouthfgeishadeyesicyberpunkdheadeblackdhandhgelatineditemfhacker
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i120",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i1",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i7",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i32",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i45",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i58",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i82",
        Lx"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i96"]
text/html;charset=utf-8
jbackgroundncyberpunk citydbodydpinkgclothesearmordnosefbuttonemouthehappydeyeskdropped eyedheadewhitedhanddpinkditemfpoison
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i111",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i13",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi1",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i46",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i78",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i84",
        Lx"/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi10"]
text/html;charset=utf-8
jbackgroundilost landdbodyfrottengclothesnnative ordinaldnoseccutemouthehappydeyeskdropped eyedheadeblackdhandfrottenditemhchainsaw
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i116",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i23",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i46",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i58",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
       Lx "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi6"]
text/html;charset=utf-8
jbackgroundkhackerspacedbodyeblackgclothesiPP tshirtdnosefbuttonemouthfgeishadeyeslunsuccessfuldheadimagic catdhandeblackditemerazia
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i115",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i12",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi1",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i32",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i55",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i68",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        "Lx/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i101"]
text/html;charset=utf-8
jbackgroundilost landdbodyeblackgclothesjBTC bikinidnoseccutemouthgwhistledeyesicyberpunkdheaddgreydhandeblackditemedonut
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i116",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i7",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i37",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i45",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i65",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        "Lw/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i94"]
text/html;charset=utf-8
jbackgroundfforestdbodyhturkoisegclothesicyberpunkdnoseesmallemouthgwhistledeyesicyberpunkdheadlunsuccessfuldhandhturkoiseditemilaser gun
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i112",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i17",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i37",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i45",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i76",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i98"]
text/html;charset=utf-8
jbackgroundkhackerspacedbodyfrottengclothesjBTC bikinidnosedtallemouthgwhistledeyeslunsuccessfuldheaderamendhandfrottenditemfshroom
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i115",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i7",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i37",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i55",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i73",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
        Lx"/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi11"]
text/html;charset=utf-8
jbackgroundispaceshipdbodydpinkgclotheshexplorerdnosehbleedingemouthehappydeyesgmissingdheadmbounty hunterdhanddpinkditemfledger
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i119",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i18",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i51",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i59",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i84",
        Lx"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i99"]
text/html;charset=utf-8
jbackgroundilost landdbodyhskeletongclothesfteareddnosedtallemouthcsaddeyeskdropped eyedheadfhelmetdhandhskeletonditemftrader
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i116",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i5",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i29",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i46",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i66",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i86",
       Lz "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i103"]
text/html;charset=utf-8
jbackgroundcCLIdbodyhturkoisegclothesiPP tshirtdnosedcuteemoutheseweddeyeshBTC lookdheaddgreydhandhturkoiseditemcXMR
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i110",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i12",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i42",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i65",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i92"]
text/html;charset=utf-8
jbackgroundkfuture citydbodyfrottengclothesiPP hoodiednosehbleedingemouthehappydeyeskbrainwasheddheadimagic catdhandfrottenditemdstar
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i113",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i11",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i43",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i68",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
        Lx"/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi12"]
text/html;charset=utf-8
jbackgroundczbrdbodyegreengclothesfteareddnoseesmallemouthgwhistledeyeskbrainwasheddheadcspydhandegreenditemfpoison
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i122",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i2",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i29",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i37",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i43",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i75",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i83",
       Ly "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi10"]
text/html;charset=utf-8
jbackgroundgCLI devdbodydpinkgclothesinurturingdnoseccutemouthfgeishadeyesdmtrxdheadmbounty hunterdhanddpinkditemlhungry plant
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i109",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i25",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i32",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i52",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i59",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i84",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i97"]
text/html;charset=utf-8
jbackgroundetraindbodyhturkoisegclothesrpsychedelic tshirtdnoseesmallemoutheseweddeyesfhollowdheadfhelmetdhandhturkoiseditembPP
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i120",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i28",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i48",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i66",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i91"]
text/html;charset=utf-8
jbackgroundcCLIdbodydpinkgclothesrpsychedelic tshirtdnosedcuteemouthesmiledeyeskbrainwasheddheadnBTC headphonesdhanddpinkditemfledger
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i110",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i28",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i43",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i56",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i84",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i99"]
text/html;charset=utf-8
jbackgroundkhackerspacedbodyeblackgclothesrpsychedelic tshirtdnoseesmallemouthehappydeyesgcuriousdheaddgreydhandeblackditemgBTC mag
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i115",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i28",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i44",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i65",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        Lx"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i88"]
text/html;charset=utf-8
jbackgroundcCLIdbodydpinkgclotheslunsuccessfuldnoseesmallemouthcsaddeyesgcuriousdheaderamendhanddboneditemhchainsaw
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i110",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i30",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i44",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i73",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i81",
       Lx "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi6"]
text/html;charset=utf-8
jbackgroundkpsychedelicdbodyegreengclothesrpsychedelic tshirtdnoseesmallemouthesmiledeyeskbrainwasheddheaddphatdhandegreenditembPP
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi15",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i2",
t/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i28",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i43",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i71",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i83",
        Lx"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i91"]
text/html;charset=utf-8
jbackgroundczbrdbodyhskeletongclotheshexplorerdnoseesmallemouthcsaddeyeshBTC lookdheadescarfdhandhskeletonditemlhungry plant
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i122",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i5",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i18",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i42",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i74",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i86",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i97"]
text/html;charset=utf-8
jbackgroundcCLIdbodyhgelatinegclothesfkimonodnosedtallemouthcsaddeyeskdropped eyedheadbVRdhandhgelatineditemfpoison
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i110",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i1",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i20",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i46",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi2",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i82",
        Lx"/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi10"]
text/html;charset=utf-8
jbackgroundgCLI devdbodyegreengclothesjBTC kimonodnosefbuttonemouthcsaddeyeskbrainwasheddheaddphatdhandegreenditemcXMR
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i109",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i2",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i8",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi1",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i43",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i71",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i83",
        "Lw/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i92"]
text/html;charset=utf-8
jbackgroundispaceshipdbodyhturkoisegclotheshexplorerdnoseccutemouthesmiledeyesgcuriousdheadcspydhandhturkoiseditembPP
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i119",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i18",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i44",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i75",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i91"]
text/html;charset=utf-8
jbackgroundkpsychedelicdbodyegreengclotheslunsuccessfuldnosedtallemouthesmiledeyeskbrainwasheddheaddgreydhandegreenditemeSigma
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi15",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i2",
t/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i30",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i43",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i65",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i83",
        Lw"/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi4"]
text/html;charset=utf-8
jbackgroundgCLI devdbodyhskeletongclothesicyberpunkdnosedcuteemouthgwhistledeyesgmissingdheadfhelmetdhandhskeletonditemgBTC mag
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i109",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i5",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i17",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i37",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i51",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i66",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i86",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i88"]
text/html;charset=utf-8
jbackgroundgCLI devdbodyegreengclothesjBTC tshirtdnoseccutemouthcsaddeyesgcuriousdheadgclassicdhandegreenditemeflame
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i109",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i2",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i10",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i44",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i60",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i83",
       Lx "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi7"]
text/html;charset=utf-8
jbackgroundjBTC portaldbodyfrottengclotheshhawaiiandnoseccutemouthesmiledeyesicyberpunkdheadnBTC headphonesdhandfrottenditemhchainsaw
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i107",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i19",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i45",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i56",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
       Lx "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi6"]
text/html;charset=utf-8
jbackgrounddmtrxdbodyhturkoisednosehbleedingemouthesmiledeyeskdropped eyedheadnBTC headphonesdhandhturkoiseditemedonut
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i118",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i46",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i56",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i94"]
text/html;charset=utf-8
jbackgroundczbrdbodydpinkgclothesfwizarddnoseesmallemoutheseweddeyesgmissingdheadicyberpunkdhanddpinkditembPP
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i122",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i31",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i51",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i62",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i84",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i91"]
text/html;charset=utf-8
jbackgroundhgraffitidbodyhturkoisegclotheseninjadnosedcuteemouthcsaddeyeslunsuccessfuldheadnBTC headphonesdhandhturkoiseditemftrader
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i114",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i24",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i55",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i56",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
       Lz "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i103"]
text/html;charset=utf-8
jbackgrounddmtrxdbodyeblackgclotheslorange aprondnoseccutemouthcsaddeyescsaddheadfpiratedhandeblackditemedonut
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i118",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i26",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i53",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i72",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        Lx"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i94"]
text/html;charset=utf-8
jbackgroundhgraffitidbodyhgelatinegclothesnnative ordinaldnosehbleedingemouthesmiledeyeskbrainwasheddheadlunsuccessfuldhandhgelatineditemerazia
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i114",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i1",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i23",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i43",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i76",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i82",
        Ly"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i101"]
text/html;charset=utf-8
jbackgroundkfuture citydbodyfrottendnoseesmallemouthfgeishadeyesdmtrxdheadlunsuccessfuldhandfrottenditemlhungry plant
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i113",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i32",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i52",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i76",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i97"]
text/html;charset=utf-8
jbackgroundcCLIdbodyhgelatinegclotheshhawaiiandnosedcuteemouthgwhistledeyesdmtrxdheadecrowndhandhgelatineditemdstar
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i110",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i1",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i19",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i37",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i52",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i61",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i82",
       Ly "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi12"]
text/html;charset=utf-8
jbackgroundcCLIdbodyfrottengclothesicyberpunkdnosehbleedingemouthesmiledeyeshBTC lookdheadcfoxdhandfrottenditembPP
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i110",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i17",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i42",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i63",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
        Lx"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i91"]
text/html;charset=utf-8
jbackgroundgwindowsdbodydpinkgclothesfkimonodnosehbleedingemouthesmiledeyeselaserdheadfgeishadhanddboneditemdrune
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i121",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i20",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i50",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i64",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i81",
        Ly"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i102"]
text/html;charset=utf-8
jbackgroundhgraffitidbodyeblackgclotheshhawaiiandnosedcuteemouthgwhistledeyescsaddheaderamendhandeblackditemgyinyang
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i114",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i19",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i37",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i53",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i73",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        Ly"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i104"]
text/html;charset=utf-8
jbackgroundetraindbodyeblackgclothesiPP tshirtdnosefbuttonemouthehappydeyeselaserdheadfgeishadhandeblackditembPP
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i120",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i12",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi1",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i50",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i64",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        "Lw/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i91"]
text/html;charset=utf-8
jbackgroundetraindbodyfrottengclothesfkimonodnoseccutemouthfgeishadeyeslunsuccessfuldhandfrottenditemcBTC
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i120",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i20",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i32",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i55",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i89"]
text/html;charset=utf-8
jbackgroundkhackerspacedbodydpinkgclothesicyberpunkdnoseesmallemouthehappydeyesicyberpunkdheadbVRdhanddpinkditemdrune
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i115",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i17",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i45",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi2",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i84",
        Ly"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i102"]
text/html;charset=utf-8
jbackgroundkhackerspacedbodyhturkoisegclotheslorange aprondnosehbleedingemouthgwhistledeyeslunsuccessfuldheadbVRdhandhturkoiseditemjdoubleshot
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i115",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i26",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i37",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i55",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi2",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
        "Lw/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i95"]
text/html;charset=utf-8
jbackgroundetraindbodyegreendnosehbleedingemouthehappydeyeshBTC lookdheadewhitedhandegreenditemedonut
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i120",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i2",
nt/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i42",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i78",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i83",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i94"]
text/html;charset=utf-8
jbackgroundncyberpunk citydbodyeblackgclothesiPP tshirtdnosedtallemouthcsaddeyeseseweddheadeblackdhandeblackditemedonut
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i111",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i12",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i54",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i58",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        Lx"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i94"]
text/html;charset=utf-8
jbackgroundhmountaindbodyeblackgclothesjBTC tshirtdnoseesmallemouthcsaddeyeskdropped eyedheadfminingdhandeblackditemilaser gun
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i117",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i10",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i46",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i69",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        Lx"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i98"]
text/html;charset=utf-8
jbackgroundhmountaindbodyfrottengclothesfartistdnosedtallemouthesmiledeyesdmtrxdheaddwolfdhandfrottenditemcZTG
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i117",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i14",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i52",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i80",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i93"]
text/html;charset=utf-8
jbackgroundibeeyoselfdbodyhskeletongclotheslunsuccessfuldnosehbleedingemouthcsaddeyesfhollowdheadewhitedhandhskeletonditemfhacker
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i108",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i5",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i30",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i48",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i78",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i86",
        Lx"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i96"]
text/html;charset=utf-8
jbackgroundilost landdbodyeblackdnoseesmallemouthcsaddeyescsaddheaderamendhandeblackditemfhacker
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i116",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i53",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i73",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i96"]
text/html;charset=utf-8
jbackgroundhgraffitidbodyfrottengclothesiPP hoodiednoseesmallemouthcsaddeyeskdropped eyedheaddphatdhandfrottenditemdrune
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i114",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i11",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i46",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i71",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
       Lz "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i102"]
text/html;charset=utf-8
jbackgroundcCLIdbodydpinkgclothesinurturingdnoseesmallemoutheseweddeyesfhollowdheadlunsuccessfuldhanddboneditemcZTG
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i110",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i25",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i48",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i76",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i81",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i93"]
text/html;charset=utf-8
jbackgroundkfuture citydbodyeblackgclothesrpsychedelic tshirtdnosehbleedingemouthfgeishadeyesfhackerdheadbVRdhandeblackditemedonut
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i113",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i28",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i32",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i47",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi2",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        "/Lvcontent/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i94"]
text/html;charset=utf-8
jbackgroundgwindowsdbodyfrottengclotheshexplorerdnosedtallemouthcsaddeyeskbrainwasheddheadcfoxdhandfrottenditemfledger
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i121",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i18",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i43",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i63",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i99"]
text/html;charset=utf-8
jbackgroundkhackerspacedbodyeblackgclothesnnative ordinaldnosedtallemoutheseweddeyesfhackerdheadcfoxdhandeblackditemfhacker
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i115",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i23",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i47",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i63",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        Lx"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i96"]
text/html;charset=utf-8
jbackgroundgCLI devdbodyhturkoisegclotheskbusinesswmndnoseesmallemouthcsaddeyeshBTC lookdheadglab petdhandhturkoiseditemeSigma
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i109",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i16",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i42",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i67",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
       Lx "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi4"]
text/html;charset=utf-8
jbackgroundgCLI devdbodyegreengclotheslunsuccessfuldnosedtallemouthesmiledeyesdmtrxdheadimagic catdhandegreenditemcXMR
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i109",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i2",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i30",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i52",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i68",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i83",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i92"]
text/html;charset=utf-8
jbackgroundfforestdbodyhskeletongclothesnnative ordinaldnoseesmallemouthcsaddeyeskdropped eyedheadcfoxdhandhskeletonditemfpoison
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i112",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i5",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i23",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i46",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i63",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i86",
       Ly "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi10"]
text/html;charset=utf-8
jbackgroundkfuture citydbodydpinkgclotheselatexdnosedcuteemouthgwhistledeyesjlaser 9000dheadeblackdhanddpinkditemdrune
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i113",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i22",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i37",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i58",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i49",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i84",
       Lz "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i102"]
text/html;charset=utf-8
jbackgroundcCLIdbodydpinkgclotheshexplorerdnoseccutemouthesmiledeyesgcuriousdheaddgreydhanddboneditemgyinyang
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i110",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i3",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i18",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i44",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i65",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i81",
       Lz "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i104"]
text/html;charset=utf-8
jbackgroundkhackerspacedbodyhgelatinegclothesfartistdnosefbuttonemouthesmiledeyesgmissingdheadgclassicdhandhgelatineditemlhungry plant
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i115",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i1",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i14",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi1",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i36",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i51",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i60",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i82",
        Lx"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i97"]
text/html;charset=utf-8
jbackgroundkpsychedelicdbodyegreengclotheslunsuccessfuldnosedtallemouthehappydeyesdmtrxdheaddnestdhandegreenditemcXMR
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi15",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i2",
t/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i30",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i52",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i70",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i83",
        Lx"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i92"]
text/html;charset=utf-8
jbackgroundhgraffitidbodyhturkoisegclothesicyberpunkdnosedtallemouthfgeishadeyescsaddheaderamendhandhturkoiseditemdstar
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i114",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i17",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i32",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i53",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i73",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
       Ly "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi12"]
text/html;charset=utf-8
jbackgroundilost landdbodyeblackgclotheselatexdnosedcuteemouthcsaddeyeselaserdheadfwizarddhandeblackditemmenergy shield
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i116",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i22",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i50",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i79",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        Lw"/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi9"]
text/html;charset=utf-8
jbackgroundcCLIdbodyhskeletongclotheskbusinesswmndnosedcuteemoutheseweddeyeshBTC lookdheadewhitedhandhskeletonditemhchainsaw
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i110",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i5",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i16",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i42",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i78",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i86",
       Lx "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi6"]
text/html;charset=utf-8
jbackgroundgwindowsdbodyhturkoisednosedtallemouthehappydeyeselaserdheadfgeishadhandhturkoiseditemdstar
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i121",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i50",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i64",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi12"]
text/html;charset=utf-8
jbackgroundgCLI devdbodyhturkoisegclothesjBTC piratednosedcuteemoutheseweddeyesgmissingdheaddvotedhandhturkoiseditemeflame
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i109",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i9",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i51",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i77",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
        Lw"/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi7"]
text/html;charset=utf-8
jbackgroundgwindowsdbodyfrottengclothesppost apocalypticdnoseesmallemouthcsaddeyesdmtrxdheadcfoxdhandfrottenditemmenergy shield
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i121",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i27",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i40",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i52",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i63",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
       Lx "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi9"]
text/html;charset=utf-8
jbackgroundetraindbodyeblackgclothesfkimonodnoseccutemouthcsaddeyesgcuriousdheadkanonym maskdhandeblackditemgyinyang
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i120",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i20",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i38",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i44",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i57",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        Ly"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i104"]
text/html;charset=utf-8
jbackgroundkpsychedelicdbodyeblackgclothesicyberpunkdnosedtallemouthgwhistledeyeselaserdheadlunsuccessfuldhandeblackditemeSigma
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi15",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
t/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i17",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i37",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i50",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i76",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        "Lv/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi4"]
text/html;charset=utf-8
jbackgroundkfuture citydbodyhturkoisegclothesnnative ordinaldnosedcuteemouthehappydeyeseseweddheadnBTC headphonesdhandhturkoiseditemelotus
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i113",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i6",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i23",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i54",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i56",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i87",
       Lx "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi8"]
text/html;charset=utf-8
jbackgroundkpsychedelicdbodyfrottengclothesfteareddnosedcuteemouthcsaddeyeskdropped eyedheadfpiratedhandfrottenditemcBTC
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi15",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
t/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i29",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i39",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i34",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i46",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i72",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
        Lx"/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i89"]
text/html;charset=utf-8
jbackgroundjBTC portaldbodyeblackgclothesjBTC bikinidnosehbleedingemoutheseweddeyeseseweddheadmbounty hunterdhandeblackditemfledger
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i107",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i0",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i7",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi0",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i35",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i54",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i59",
        "/content/8c78553b6144f70cec5b815184b01eee845349e59e21937bc03763fa10415fadi3",
        "/Lvcontent/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i99"]
text/html;charset=utf-8
jbackgroundgwindowsdbodyfrottengclothesrpsychedelic tshirtdnosedtallemouthehappydeyeshBTC lookdheaddgreydhandfrottenditemcETH
  <body style="margin: 0;padding: 0">
    <script src="/content/b52f97a91555acce06f7cc1b42455a2b785be3a5cd3f4351b5358d1591690e2ei0"></script>
    <canvas id="canvas" style="width: 100%; height: auto; image-rendering: pixelated" width="60" height="60"></canvas>
      draw(document.getElementById('canvas'), [
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i121",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i4",
nt/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i28",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i41",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i33",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i42",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i65",
        "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i85",
       Ly "/content/afff2b02b63a1558f6ae1cb304ce07ccb00fe306dace923294e6e6eeaf2d1f91i90"]
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"4000000"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"RKGK","amt":"777"}h!
text/plain;charset=utf-8
Lu<!DOCTYPE html><script 3247 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3251 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3199 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3222 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3255 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3215 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Bj@=:ETH.ETH:0x9d6a9219de8E7F08A24A9f843B15B76c9D3FA6A0:0/1/0:td:70
Bj@=:BSC.BNB:0x07c393177Ce3eBe4F2987eB521ca932B195F482f:0/1/0:td:70
2f/Foundry USA Pool #dropgold/
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"sats","amt":"10385568547.9"}h!
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"sats","amt":"155129085.582"}h!
FjDOUT:68B776C0569101E3EC6741B3CBC37B4A735BF4F7D3A10255D5BD4700B16B5C4F
FjDOUT:1FA8D06F8A053E7BB561120041264F8B668431E4C1E326E2B1E266341A302F4F
FjDOUT:A3CF657384AC190BEA6FAB05669488379B6C722257CFCE7FCA0130501EC31EF0
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"200"}h!
FjDOUT:483B5F31F84B9C0392A52AD19FF2162CDD86DBE162AB67247C486246FCAD964B
CjA=:LTC.LTC:ltc1qetdcgrs0mg2u3lzjehr6fphjfsh0awqm75jhec:0/1/0:ti:70
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"PGID","amt":"29999"}h!
FjDOUT:8F6BC0300E1E3D90B9D383A2FD50B589BF351C5D5123C08AF00B46F0CEA40279
FjDOUT:632607D40C96F12BDD3614BBC81365DDEA800819187B4AFDA13726E365819D7E
FjDOUT:21DAE7305B98C466E4C35D969F67E5E3296C1F46814D2C22CDA46A3D7408BCF9
FjDOUT:44CEAA301F944DB41B5C82A3196E9CAC81C1C246DA6D58AD9AF4A71D4302EBCE
FjDOUT:A26CE81465504E90933D5A5CEAFC8F444F9381EF823C533A9EAA68BFAD622AD0
FjDOUT:D9B97CBCF33E8E4DD8FD195D72D05BC9404C3B7C6E077F8EA8EE5489E688F9F7
FjDOUT:1F7B3E2EB9EEB9BDEDFA7E09617E07C03E1780944F3C698563F25CD8167ECB65
FjDOUT:E8635BC5345732C417A2BD3A5AFBB331568FE1D902F54ABCE2351FC75B4B5BC9
Bj@=:ETH.ETH:0x7F9C570694a5CeA73799105A4978218fdC12BBBF:0/1/0:ti:70
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"293.2"}h!
CjA=:ETH.USDT:0x5add3aA1c08018DFcfDcb053DaaF2976Cd4B5a73:0/1/1:ej:75
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"PGID","amt":"2000"}h!
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"Sqts","amt":"2220000000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"TFER","amt":"10000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"PGID","amt":"2000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"DNCX","amt":"20000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"15000000000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"15000000000"}h!
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"5290"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"4999"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"TFER","amt":"10000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"30000000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"TFER","amt":"10000"}h!
text/plain;charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"rats","amt":"200000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"DNCX","amt":"20000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"eorb","amt":"5000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"core","amt":"10000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"2000000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"DERP","amt":"500000"}h!
33333333333333333333333333333333S
text/html;charset=utf-8
<script data-s="0xfedb2cfd990726fae30262b78622971315b40e47b5f7092d62933856f8a1f720" src="/content/f80b93466a28c5efc703fab02beebbf4e32e1bc4f063ac27fedfd79ad982f2cei0"></script><body style="display: none"></body>
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"1490"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"TFER","amt":"10000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"66666666666"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"50000000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"88888888888"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"1000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"TFER","amt":"10000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"77777777777"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"99999999999"}h!
text/plain;charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"rats","amt":"325174793"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"TFER","amt":"10000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"5000000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"66666666666"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"1000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"55555555555"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"1000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"TRAC","amt":"4000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"MTMT","amt":"30000"}h!
Bj@=:BSC.BNB:0x9C9f1e7837c6C7205B9aA8Ec9e272f56aaEB8EF7:0/1/0:td:70
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"piza","amt":"3429"}h!
Bj@=:ETH.ETH:0x4c509ff5a7520754573F68505e91F79421AdE4F8:0/1/0:ti:70
Bj@=:ETH.ETH:0x06d10e8CeCc9081A598DbD92510468eCB4eBB811:0/1/0:ti:70
CjA=:LTC.LTC:ltc1qmk9fcptkhfvznxvjy354t770950mxcayzdg33u:0/1/0:ti:70
,j*0x67607FFDB3446d3E92649da58a20424503845596
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"XDAO","amt":"2000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"XDAO","amt":"2000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"XDAO","amt":"2000"}h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841626"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"@LFG","amt":"55000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"XDAO","amt":"2000"}h!
33333333333333333333333333333333S
DjB=:AVAX.AVAX:0x1b4055748f334D80b424337B69272c7db6226321:0/1/0:td:70
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
text/plain;charset=utf-8
L]{"p":"brc-20","op":"deploy","tick":"NAGPR","lim":"10000","max":"21000000","self_mint":"true"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"aisi","amt":"10000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"aisi","amt":"10000"}h!
text/plain;charset=utf-8
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
text/plain;charset=utf-8
Lu<!DOCTYPE html><script 3277 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3284 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3279 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
{"p":"BRC-100","op":"burn3","tick":"corgi","amt":"200000000000","cop":"sw","to":"bos:lp_corgi_bos","ext":{"aom":"33440.381713754230878013","dl":"1716354012"}}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"250"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"1000"}h!
text/plain;charset=utf-8
{"p":"lam","op":"multi","calls":[{"contract":"dep:dmt:RAMBO","function":"mint","args":[]},{"contract":"dep:dmt:LAMBO","function":"mint","args":[]},{"contract":"dep:dmt:FIRST","function":"mint","args":[]},{"contract":"dep:dmt:LAMB","function":"mint","args":[]},{"contract":"dep:dmt:LAMBADA","function":"mint","args":[]},{"contract":"dep:dmt:SHAKES","function":"mint","args":[]},{"contract":"dep:dmt:GME","function":"mint","args":[]},{"contract":"dep:dmt:COCC","function":"mint","args":[]},{"contract":"dep:dmt:OXBT","func
tion":"mint","args":[]}]}h!
2f/Foundry USA Pool #dropgold/
QjLN=:ETH.USDT-EC7:0x9a92E60a4eac6b7057c9032127Bdbe03DA23E002:1098114944020:xdf:30
FjDOUT:BFD3C0C4226CFD1A4585734545C6BA1C7C8DB93C060E08F16CB8D117C0969EB1
FjDOUT:4B23F73B68B36E079F76D7AED23ACCF43099531D805D08EAEDCE27B6FF2ABA5B
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"Mirac","amt":"800000000"}h!
text/plain;charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"19MM","amt":"100000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"2000000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"PUPS","amt":"20"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"19MM","amt":"50000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"2000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"3000000"}h!
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"rune","amt":"30000"}h!
Lu<!DOCTYPE html><script 3264 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3281 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841627"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"NOOT","amt":"500000"}h!
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3265 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3239 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3256 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3196 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"mint","tick":"aeme","amt":"8100000000"}h!
text/html;charset=utf-8
hburialIdxB62aafb64290bdbb3d25556bacc53e66e90ec2a78be2415c2d109dcedd268f304i0gboneyIdxB2c97f0323e511377308bbdaa28878cfc9162fac315709214511247b338955dd2i0dnamewthoughtful-tomato-bisonpminingMultiplier
<!doctype html><html lang="en"><head><meta charset="utf-8"/><link href="/content/1a6e5dca0c78021028ce039409a0f2f40247798b433548e30afba1c498d6e030i0" rel="stylesheet"/><script src="/content/a9f6a9b050af3de1a4ce714978c1f2231ba731f1f46731a16d0e411f89308566i0"></script></head><body><script src="/content/58025710c2bcc8ff006859aa94254c18f5c424504386449522a666a99559ca6ei0" defer="defer"></script></body></html>h!
Lu<!DOCTYPE html><script 3269 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3272 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3271 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3296 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3307 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
DjB=:e:0x2Ba66E2CDEC46853ee9F741cd17894Fc567C699D:35740e5/15/11:rg:15
EjC=:ETH.ETH:0xdc1bdc4e7e2dda23262c7ff5b0f23157600d7686:95758411:ts:30
SjLP=:GAIA.ATOM:cosmos1ufahyv99tq4lpfgldhks072ag0pf70jgprctnr:118851749800/3/16:t:302
text/plain;charset=utf-8
D{"p":"brc-20","op":"transfer","tick":"sats","amt":"199935815147.62"}h!
text/plain;charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"sats","amt":"369100000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"ordi","amt":"4.48"}h!
text/plain;charset=utf-8
cbrc-20:transfer:moto=1000
EjCMIG APPROVED::4.87183643BTC::BLOCK_ALLOCATED_841673::FEE 0.01681113
FjDOUT:BC33666D802794383008588D26323D3F1E6282A6AE4DA8EE556D5FB395D6C041
Lu<!DOCTYPE html><script 3278 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3235 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3252 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
cbrc-20:transfer:moto=500
GjE=:ETH.USDT-EC7:0xFAF135C55f350F8D28d7BFa12b35347Db8516061:0/1/0:ti:70
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"piin","amt":"6181855.99"}h!
FjDOUT:F6ADDF6E9E71972ED5C93B3927A5694791FD4A2E703C2D766044B370702095C1
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"sxio","amt":"2250.782"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"100988"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"AINN","amt":"99990"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"AINN","amt":"98990"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"AINN","amt":"99990"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"107989"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"10000000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"FRAM","amt":"95611"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"77777777777"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"88888888888"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"109989"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"
","amt":"5088888888"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"135991"}h!
Lu<!DOCTYPE html><script 3280 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"19MM","amt":"25000000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"99999999999"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"19MM","amt":"10000000"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"
","amt":"5088888888"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"113992"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"110990"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"118987"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"153991"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"104987"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"231970"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"109993"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"AINN","amt":"88990"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"aoas","amt":"500"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"AINN","amt":"94990"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"104989"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"AINN","amt":"99990"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"
","amt":"5188888888"}h!
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3292 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3327 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3324 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3321 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"AINN","amt":"99990"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"
","amt":"6555555555"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"slor","amt":"10000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"55555555555"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"4999"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"109989"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"250"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"
","amt":"9888888888"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"aoas","amt":"750"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"
","amt":"6500000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"AINN","amt":"99990"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"10900000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"MTMT","amt":"12500"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"AINN","amt":"99990"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"250"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"ordi","amt":"9339.2"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"208971"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"aoas","amt":"800"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"
","amt":"8000000000"}h!
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"sats","amt":"1057044540000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"10000000000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"371373"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"AINN","amt":"99990"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"BMBI","amt":"22423"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"10000000000"}h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
FjDOUT:B8D5E19EE1DF763987DF39C5DB6A316FD8A3F2F38AE78213CE114AD1C280DDA6
FjDOUT:3B99EF7E64AA069FD5317F3AA0C0912082B43977E4BFF14E1BA32C5F28325CD6
FjDOUT:BEA6268B03BDBE7EBEC28D054E07AFA5770314CF2062F3CD637F279F92EC8D28
FjDOUT:B4086261A6D98055CF932712C89EBAEA4F35F330A6FE00999C302D95CF1269EB
FjDOUT:B8F48A4461BDF0E8708D5C9307202584AF67C4286AE0BB7F3E627F2E5FA18CA8
FjDOUT:FC379EEE6C3271C2A6A6E81B89477B6B3AC23C105A18749B9D69C2E1C0F12A6E
FjDOUT:B46BA35BCCAF0439901BBB9E9B8D892AB573DDA8F2B05325306D2E4007C25638
FjDOUT:984C7A8B00C62B46909A152F6DC26CC6D2DB40556839652253651ECD7285BFD5
FjDOUT:353D1C1CE35863499C1EFA3B075DCE0072564535EB555F7A487B6D33D8FEE342
FjDOUT:41890A6A77023797F2826DB4B4C6BFF4EB5DD44A777E73FBB3A41FA81B9D410A
FjDOUT:F757E7BDC132101054F343B87F851F2F98A2F45B9B2757CDAC86F425F8C85E93
FjDOUT:86D34666EF33989B8321347C58B39C5CFC5C41DC6B20903FAF8D1D7408E7E491
FjDOUT:660E41C0256948D6A8C667098EB26D5E54571081E1A12A7CD7C7B7BC219D8F09
FjDOUT:CE176F090CE8F960B4821E093B3B20D9772C3F58E6A0C1B4CD140DB136209C91
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"DNCX","amt":"40000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"DNCX","amt":"38000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"15000000000"}h!
text/plain;charset=utf-8
C{"p":"brc-20","op":"transfer","tick":"sats","amt":"49983631959.14"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"16666666666"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"ethw","amt":"730000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"250"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"66666666666"}h!
text/html;charset=utf-8
<script data-s="0xeb7ff37b133a1a38d8f8921fd7621dbf787e794aa1063992941e143def3ed7af" src="/content/f80b93466a28c5efc703fab02beebbf4e32e1bc4f063ac27fedfd79ad982f2cei0"></script><body style="display: none"></body>
text/plain;charset=utf-8
C{"p":"brc-20","op":"transfer","tick":"
","amt":"3333333333.888"}h!
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"
","amt":"1000000000000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"26666669661"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"5000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"lion","amt":"101388"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"2000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"16000000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"5000000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"77777777777"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"10000000000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"WZRD","amt":"293.20000000"}h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841628"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"
","amt":"8888888888"}h!
,j*0x03474cC013DA37e0499F1b09d5649888fB4bE99a
Lu<!DOCTYPE html><script 3302 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"sats","amt":"258750000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"ZBIT","amt":"391"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"95.55"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"@LFG","amt":"10000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"4176"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"119.81"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"92.88"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"WZRD","amt":"1000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"98.88"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"250"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"DNCX","amt":"60000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"mice","amt":"40000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"mice","amt":"60000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"92.88"}h!
,j*0x3393b9b38e7442ef46cb90ef570ca60269189376
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"VMPX","amt":"24157"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"PEPE","amt":"2000"}h!
Lu<!DOCTYPE html><script 3240 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"ordi","amt":"2764.5"}h!
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
,j*0x2eb536846075f2337c63893185CdD66A91F06612
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"xDAO","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"xDAO","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"xDAO","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"xDAO","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"xDAO","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"xDAO","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"xDAO","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"xDAO","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"xDAO","amt":"500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"xDAO","amt":"500"}h!
,j*0x546a5E4a2f681a046fdDFe0Ebe7658D8eeD6785D
Bj@=:ETH.ETH:0x65c097B69607124e0F23AB41fe13008B2909b37d:0/1/0:ti:70
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
GjE=:ETH.USDC-B48:0x13a809418131a6cB1D4827650C520060E5e243BB:0/1/0:ti:70
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"MTMT","amt":"16500"}h!
,j*0x80e4a18db248c7de222fa9f6e48372590456694d
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"zbit","amt":"195"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"100"}h!
text/plain;charset=utf-8
9{"p":"b137","op":"did-bind","tld":"ink","name":"andrynv"}h!
Lu<!DOCTYPE html><script 3301 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3299 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3273 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"600"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"250"}h!
FjDOUT:A96E16EB961D7184456AE971F86C87D8111F492AA4B6721BA1BBABC9FEE6FC9A
text/plain;charset=utf-8
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"
","amt":"5000000000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"PGID","amt":"10"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"250"}h!
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"XBTCX","amt":"120000000000"}h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841629"}h!
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
,j*0x94d95A23Beb8530879b5E6bE1C0Ad378FEdD4673
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"roup","amt":"100000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
{"p":"lam","op":"multi","calls":[{"contract":"dep:dmt:RAMBO","function":"mint","args":[]},{"contract":"dep:dmt:LAMBO","function":"mint","args":[]},{"contract":"dep:dmt:FIRST","function":"mint","args":[]},{"contract":"dep:dmt:LAMB","function":"mint","args":[]},{"contract":"dep:dmt:LAMBADA","function":"mint","args":[]},{"contract":"dep:dmt:SHAKES","function":"mint","args":[]},{"contract":"dep:dmt:GME","function":"mint","args":[]},{"contract":"dep:dmt:COCC","function":"mint","args":[]},{"contract":"dep:dmt:OXBT","func
tion":"mint","args":[]}]}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"mice","amt":"300000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"STST","amt":"10000.0"}h!
kmint_tickeraaenonce
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
Bj@=:ETH.ETH:0x03b0a20761977fCA3A7d22FAbF608dfF36e3b62D:0/1/0:ti:70
Bj@=:ETH.ETH:0x53784698B8540D6293C37fe6067503030d1e36c1:0/1/0:ti:70
Lu<!DOCTYPE html><script 3287 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3293 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3300 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3291 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3275 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3276 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
,j*0x67607FFDB3446d3E92649da58a20424503845596
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"400000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"400000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"400000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"400000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"400000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"400000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"400000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"400000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"400000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"400000"}h!
Lu<!DOCTYPE html><script 3303 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3288 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3289 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Bj@=:BCH.BCH:qr4l6c84zjpxz6qe3gqvxprx5p2kkg4qf5n3lk9ge8:0/1/0:td:70
Bj@=:ETH.ETH:0xd0DA1ccEcE1c205baC9F0af50c2dCF54a9895a84:0/1/0:td:70
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"ordi","amt":"492.2"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"20374005020"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"piza","amt":"732"}h!
FjDOUT:C70DA4063EA4D4646529ADEC6EC1E63AE0548046DE31ACBC467E088D71E1A5AF
text/html;charset=utf-8
    <meta charset="UTF-8" />
    <meta name="viewport" content="width=device-width, initial-scale=1.0" />
    <title>diadepixales</title>
  <body style="margin: 0px">
      <img style="width:100%;margin:0px" src="/content/681b5373c03e3f819231afd9227f54101395299c9e58356bda278e2f32bef2cdi0" />
text/plain;charset=utf-8
6{"p":"brc-20","op":"transfer","tick":"PGID","amt":"1"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"Bear","amt":"1000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"piza","amt":"186"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"piza","amt":"1852"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"
","amt":"5188888888"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"66666666666"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"slor","amt":"998"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"2000000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"44444444444"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"55555555555"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"PGID","amt":"10"}h!
FjD=:e:0x748140db13eac4216008efdc6fa6c3a877de3a3e:1516860601/3/4:oky:30
dnameeRM #2jattributes
jtrait_typebBGevalueebg 02
jtrait_typedBodyevaluegbody 10
jtrait_typebEEevaluerelectric effect 03
jtrait_typeeFrameevaluehframe 01
jtrait_typegMonitorevaluekmonitor  03
jtrait_typefSymbolevalueaY
jtrait_typedTypeevaluegtype 01
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841630"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"WZRD","amt":"225"}h!
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3274 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
La{"p":"BRC-100","op":"mint3","tick":"bos","amt":"47771.9738","cop":"w3","from":"bos:lp_corgi_bos"}h!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
Bj@=:ETH.ETH:0x70012aCac207b8b4842761AB86F71e57De6Ed46F:0/1/0:ti:70
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"zbit","amt":"109"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
7{"p":"b137","op":"did-bind","tld":"b137","name":"rune"}h!
text/plain;charset=utf-8
{"p":"lam","op":"multi","calls":[{"contract":"dep:dmt:RAMBO","function":"mint","args":[]},{"contract":"dep:dmt:LAMBO","function":"mint","args":[]},{"contract":"dep:dmt:FIRST","function":"mint","args":[]},{"contract":"dep:dmt:LAMB","function":"mint","args":[]},{"contract":"dep:dmt:LAMBADA","function":"mint","args":[]},{"contract":"dep:dmt:SHAKES","function":"mint","args":[]},{"contract":"dep:dmt:GME","function":"mint","args":[]},{"contract":"dep:dmt:COCC","function":"mint","args":[]},{"contract":"dep:dmt:OXBT","func
tion":"mint","args":[]}]}h!
,j*0x835E539bD35e47f7017786b7868F8EA749e453A7
%&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz
&'()*56789:CDEFGHIJSTUVWXYM
EjC=:ETH.ETH:0xdc1bdc4e7e2dda23262c7ff5b0f23157600d7686:95759959:ts:30
Bj@=:ETH.ETH:0xd0DA1ccEcE1c205baC9F0af50c2dCF54a9895a84:0/1/0:td:70
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"sats","amt":"17182556.141"}h!
Lu<!DOCTYPE html><script 3306 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3308 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3326 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3314 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3329 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
CjA=:KUJI.KUJI:kujira1cgt6hhk87klpsdacqyu4lyjkjxuvy6gjmr2rvc::wr:100
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"PGID","amt":"29999"}h!
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"Sqts","amt":"1000000000000"}h!
FjDOUT:D23F1D543AE952A47527A0A5CBC1E1ECB94C6240D1230A912C0674E5F30BB9D6
FjDOUT:AF0B030AE1A1DDA94F3A974A02A3FBEC12D432C32485A3DD67BB9DCAB9FE37AD
FjDOUT:801305A1F19D0627599F4996C2414C79CE2A394D44EBEC175346F88CAD398C67
FjDOUT:D63CBE9952055FD9B5210D29914431B2479987553D1D61C93099ED962121B78B
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"OFAN","amt":"1035"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"DFSN","amt":"300"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"DNCX","amt":"1472500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"slor","amt":"799"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"23600000000"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"BTCmo","amt":"100000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"DNCX","amt":"1694800"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"ordi","amt":"603.32"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"20000000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"slor","amt":"10000"}h!
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"satx","amt":"1000000000009"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"FBTC","amt":"200"}h!
text/plain;charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"ARFU","amt":"500000000"}h!
GjE=:ETH.USDT-EC7:0x218CCc9De4A9018C2F5872200a7cBDD9ED662E36:0/1/0:ti:70
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"TRIO","amt":"150"}h!
uiCCPkCGColorSpaceDisplayP3
xiTXtXML:com.adobe.xmp
<x:xmpmeta xmlns:x="adobe:ns:meta/" x:xmptk="XMP Core 6.0.0">
   <rdf:RDF xmlns:rdf="http://www.w3.org/1999/02/22-rdf-syntax-ns#">
      <rdf:Description rdf:about=""
            xmlns:dc="http://purl.org/dc/elements/1.1/"
            xmlns:tiff="http://ns.adobe.com/tiff/1.0/"
            xmlns:Iptc4xmpExt="http://iptc.org/std/Iptc4xmpExt/2008-02-29/">
            <rdf:Alt>
               <rdf:li xml:lang="x-defaultM
">CryptOrdinals</rdf:li>
            </rdf:Alt>
         </dc:title>
         <tiff:YResolution>132</tiff:YResolution>
         <tiff:XResolution>132</tiff:XResolution>
         <tiff:PhotometricInterpretation>2</tiff:PhotometricInterpretation>
         <tiff:ResolutionUnit>2</tiff:ResolutionUnit>
         <Iptc4xmpExt:ArtworkTitle>CryptOrdinals</Iptc4xmpExt:ArtworkTitle>
      </rdf:Description>
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"16ec362c368f056294351ca215bef985a3f143c8d89d26f42a7dd068dc60e5a3","iid":"100Ordinals","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":63,"minter":"bc1plq2hr3tgtj79ce2anls9rr7j0mprrt7uedyyfvfnp2vdxpp3nezs8n5pmr","sig":"G3zWl8JcM67b6aPfD8i5sQUJxYpQAp1Vxsi8sZ9/cxnkHoqCTyJEfj/r8Dr2PpMyHNevg+dkW0gc9thZ14mDc2s="}hA
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"MTMT","amt":"13500"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"WZRD","amt":"1100"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"ordi","amt":"100"}h!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
GjE=:ETH.USDT-EC7:0x53B72Af01F3b747cd56959448e07467EE687F257:0/1/0:ti:70
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841631"}h!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3318 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
,j*0x7E9D3DeDc76e0C256d28e83a3D2d262De56795f3
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"core","amt":"20000"}h!
text/plain;charset=utf-8
{"p":"lam","op":"multi","calls":[{"contract":"dep:dmt:RAMBO","function":"mint","args":[]},{"contract":"dep:dmt:LAMBO","function":"mint","args":[]},{"contract":"dep:dmt:FIRST","function":"mint","args":[]},{"contract":"dep:dmt:LAMB","function":"mint","args":[]},{"contract":"dep:dmt:LAMBADA","function":"mint","args":[]},{"contract":"dep:dmt:SHAKES","function":"mint","args":[]},{"contract":"dep:dmt:GME","function":"mint","args":[]},{"contract":"dep:dmt:COCC","function":"mint","args":[]},{"contract":"dep:dmt:OXBT","func
tion":"mint","args":[]}]}h!
text/plain;charset=utf-8
LS{"op":"minting-claim","p":"orc-20","params":{"amt":"262.5","tick":"poi","tid":"1"}}h!
9{"p":"brc-20","op":"transfer","tick":"UTXO","amt":"4000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"core","amt":"20000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"core","amt":"20000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"core","amt":"20000"}h!
kmint_tickeraaenonce
Lu<!DOCTYPE html><script 3282 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3338 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":".com","amt":"50"}h!
,j*0x250F56566389b7b5adF20c7e3C11bBF853a365C2
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"200"}h!
2f/Foundry USA Pool #dropgold/
Bj@=:ETH.ETH:0xd0DA1ccEcE1c205baC9F0af50c2dCF54a9895a84:0/1/0:td:70
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"ordi","amt":"2380"}h!
KjI=:ETH.USDT:0x3620e4BA3927181ACb286Ff481E275FD29A39530:1065972548416:tl:50g
FjDOUT:2E1D9D4A774DB5E97056D3CAFE5960B35C4476999BC30B2A5229CD68F7BA2BF5
Bj@=:ETH.ETH:0xCE643199d64e3692001b08A8c111C853FeDF0d1d:0/1/0:ti:70
FjDOUT:4CB6A78EA1BF5116F98896F25198DE156556BC2AFB329B9DA3916CC67D852C2A
FjDOUT:001938E9312ECCB0961EBB8CD809CB80BB5104A290AD8CF97EEC560E98385290
Lu<!DOCTYPE html><script 3241 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"piie","amt":"3000000000000"}h!
text/plain;charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"rats","amt":"600000000"}h!
text/plain;charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"PEMS","amt":"115000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"PGID","amt":"1479"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"BMBI","amt":"20020"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"20000000000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"15000000000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"21666666666"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"Mirac","amt":"800000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"PGID","amt":"1500"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"10000000000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"transfer","tick":"rebt","amt":"0"}h!
Lu<!DOCTYPE html><script 3311 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"ORDI","amt":"105.96"}h!
Lu<!DOCTYPE html><script 3342 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3328 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3340 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"FSP ","amt":"9000000000000"}h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841632"}h!
text/plain;charset=utf-8
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","amt":"100000","tick":"roup"}h!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
Lu<!DOCTYPE html><script 3263 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3184 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"STST","amt":"5000.0"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"20000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"100"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"merm","amt":"3000000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"20000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"core","amt":"20000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"merm","amt":"1400000"}h!
,j*0xc3673ADCaD9356F1B91ADD3D64D1cfe1f5431d7C
text/html;charset=utf-8
<script data-s="0xe369982ab1d171b37485378ebcb59f6daac31d5b14752c6c28c223986bbdcaab" src="/content/f80b93466a28c5efc703fab02beebbf4e32e1bc4f063ac27fedfd79ad982f2cei0"></script><body style="display: none"></body>
Lu<!DOCTYPE html><script 3315 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3322 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3310 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3297 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
)j'1tEam5YEAhHQWQFcghXa8XHcqMpfXnUB4Pp6zCDg
FjDOUT:94771141741EC6CE5297976F266B98740AA647E813D062CF3F339F270C67C4C8
FjDOUT:534F01DB77AE0F3D25AAE281885CF2ED2CA3A7FA927EDEC9C67649141593552C
FjDOUT:9BAA7DE2D233D89DFCDE6E8FF1099E7C9DA37DC815EA8E3B522A9D3863B89333
FjDOUT:F973DAEEA0BA04ECB4232A9D38130CD2C0CE97BCA381D86A3E7803D0D47BDB5B
text/plain;charset=utf-8
cbrc-20:transfer:moto=500
GjE=:ETH.USDT-EC7:0x1ab31Cf60991A6735aeA9c3dD17Df7911474a728:0/1/0:ti:70
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"Depi","amt":"185996"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"MMSS","amt":"500"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"transfer","tick":"BTCs","amt":"5"}h!
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841633"}h!
GjE=:ETH.USDT-EC7:0xDA2b89CB85fEAE55DdD4c7782BC0e83319cb2a75:0/1/0:ti:70
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
Lu<!DOCTYPE html><script 3216 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"PUPS","amt":"50"}h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3283 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
,j*0x67607FFDB3446d3E92649da58a20424503845596
Lu<!DOCTYPE html><script 3290 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Bj@=:ETH.ETH:0xd0DA1ccEcE1c205baC9F0af50c2dCF54a9895a84:0/1/0:td:70
2f/Foundry USA Pool #dropgold/r
Lu<!DOCTYPE html><script 3212 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3325 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3353 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3358 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3339 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
DjB=:s:0x985966c08ca9de5a70e4e9cd7236d4cad9921469:1611226031/3/1:t:30
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","amt":"8.8","tick":"ordi"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","amt":"941.28","tick":"ornj"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"27083520320"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"ordi","amt":"1.11132564"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"XRGB","amt":"40000"}h!
Lu<!DOCTYPE html><script 3268 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
cbrc-20:transfer:moto=250
Lu<!DOCTYPE html><script 3270 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3330 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3331 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3345 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
FjDOUT:9196BCC3DCF7DA90160095F34C99D8865A54A74A841DEBE808948C90EA99A660
<svg xmlns="http://www.w3.org/2000/svg" width="100%" height="100%" viewBox="0 0 400 400" mrc721="SATSTONE" mrc721id="2deafbe783f214ed889d46f05a5a29faabb8b37fe37a527a80c9c76ad6c76968i0"><image href="https://ordinals.com/content/20ff7b64462801794b893deb9b726f01a958e905951435bff656f98b9a2977abi0" x="0" y="0" width="400" height="400" preserveAspectRatio="xMidYMid slice"/></svg>h!
text/html;charset=utf-8
<script data-s="0xc284a6a3274cfcfbbabb8579ac7baca66b61610e64e17a5ab0328316641a1a81" src="/content/f80b93466a28c5efc703fab02beebbf4e32e1bc4f063ac27fedfd79ad982f2cei0"></script><body style="display: none"></body>
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"W
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"FRAM","amt":"65125"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"2500000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"1690"}h!
FjDOUT:602448F469D3455711A577FA3879582B2363DBF7AB61A96FCB72DBEB2BBBD6F0
FjDOUT:9BF409A8DA1C43A0A32953D65240265B46D94930E36DCEF05645E99E2B6D93AA
HjF=:AVAX.USDt-8C7:0x85c98b45d5ee686A230e2aaeb2eF2AC71f1Dc87f:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0x627C7E8dB9b0B4203A85CA2e7c37Fe97b5d172f9:0/1/0:ti:70
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"1000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"38000000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"DNCX","amt":"80000"}h!
,j*0x826DdCcbAF32DC72D62B78639A5F1198A4e3bed6
FjDOUT:E59C8599060991EFC5F40ABB1B8E8856E7054BCBDA6AD63D9896D4434845F87E
FjDOUT:7738818D06A2CFE7E009BF084B0FC55112BBDD0CDE38EDB83709E41D3B66F706
FjDOUT:FB5328C9EA6087EBA3AD3DF0418D093126A8374ADFABEB139ACA468FD34275D7
FjDOUT:F7AB6B1FC0CF8BE8BF5941BD46D1961626DC8AFB759D4C360860EC5E39799398
FjDOUT:580388FB426068F5B939F4D83BDBE1F952FC51A55E2ADED7E09365F1A57B0AF9
FjDOUT:488D800BC63E831A7EE11006C28D24FE2315C111516483092A8E0BB60B36F523
FjDOUT:525D522A5B84D3B3151C540975B9F80CF6E7E4EEC22B15BBE6716F5FB726D6D5
FjDOUT:ADF92B58E448B218D85E7A4DBE591F1C5DDC8328A097691D4C8DE7931453BA8C
FjDOUT:ED568C810FA4E2A8155088B4A7B2C12D8472D0E40727958F78484B74D9D52D06
FjDOUT:02EC52248CDC11F88B55113BC86717ECD4B80B844DE6200D5814D348EBF5F9B3
FjDOUT:2A11C7F8228029A0942A8FC0E7FC185E903FD9D037ECD1CB6B2AA5BC916CBB54
FjDOUT:4D622F69731AAA8AB1729AED6E1B8BF9EF7B82FFF7442CED7E39E0A9135BD1A2
FjDOUT:A4535411F595A62CD5B68737F6BEFFDD9B82966B94F028D48BC81E4CE1D7A69D
FjDOUT:25598DB06D78698DA12E7A9835947C29E50EAC2EC8ADA1887DFE829B7FC98F2A
FjDOUT:8434E90B00405682188B7A2F62FABF18EBEF95391968043026835BB49D1B833A
FjDOUT:0BAC654011AC08602AD205FAFC826FC9868049C8F3A7CA1C1F3222B7B421258C
FjDOUT:A7174C08276DE68C76588AA06C210337FDE3AE690873B0AF1B3F823F84688270
FjDOUT:99BC4C1719B81739C0A8D3925F4481242FE3B9C5A0E4A8E458958458F78B09A1
FjDOUT:61F5279472728FF50FA902B8B7E0E6E1E9446908EFFE45CAD20DE53F51344256
FjDOUT:23B968A3183972561D7FA0355415534FA193265C2CB6F14E8EC7640FC83186D2
FjDOUT:6729CA121E1E136B1835DD2B6AA8FB36224EEF1E6F460601B9B2A61C265A806C
FjDOUT:021C0CF1504A5004B03471217833031A7EF4A3B924BA8D7FFD281176A9B02EEE
FjDOUT:6B3DC1B8F31213E32FFD16DDA811286FDB37ED8A60EAE4169FAF6401ED3A0E24
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
GjE=:ETH.USDT-EC7:0x6f629AC84652Fe7fA45574306ABEcBfFb32E70E7:0/1/0:ti:70
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"jpeg","amt":"25000"}h!
text/html;charset=utf-8
<script data-s="0x3f3b8e1c4ecdcbcf90be3c34f687e88816f2ef5b8d96a2e86a9f6574055c6ff9" src="/content/f80b93466a28c5efc703fab02beebbf4e32e1bc4f063ac27fedfd79ad982f2cei0"></script><body style="display: none"></body>
text/plain;charset=utf-8
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"BTCs","amt":"499"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"igem","amt":"500000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"GROK","amt":"7800"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"4500000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"Bear","amt":"600"}h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841634"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"xing","amt":"132968"}h!
Lu<!DOCTYPE html><script 3304 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
GjE=:ETH.USDT-EC7:0x32d02eF47Fe503748B4C2a28786FEa6A3841Af45:0/1/0:ti:70
Bj@=:BSC.BNB:0x0661e8f3E800177F56c253Ba2668DadE212C875e:0/1/0:ti:70
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3237 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
GjE=:ETH.USDT-EC7:0xCc69830b5AAa9206e03d7365Dd33233da1dC2862:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0x5506218a7D0FF59A6Ec1b4c6c40fd59274c7BC50:0/1/0:ti:70
LjJ=:ETH.USDT-EC7:0xa82ed2444fF055b266a676D68039d137426C5bc7:98381780811:tr:0
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"PGID","amt":"100"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"SoIa","amt":"4000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"slor","amt":"998"}h!
text/plain;charset=utf-8
D{"p":"brc-20","op":"transfer","tick":"piie","amt":"950000000000000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"SoIa","amt":"17000000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"igem","amt":"200000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"igem","amt":"200000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"1450"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"2500"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"core","amt":"25000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"5000000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"SoIa","amt":"500000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"SoIa","amt":"180000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"igem","amt":"200000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"DNCX","amt":"30000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"pepe","amt":"3700"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"core","amt":"30000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1200000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"500000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"cats","amt":"300000"}h!
text/plain;charset=utf-8
cbrc-20:transfer:moto=500
text/plain;charset=utf-8
cbrc-20:transfer:moto=500
text/plain;charset=utf-8
cbrc-20:transfer:moto=500
text/plain;charset=utf-8
cbrc-20:transfer:moto=500
text/plain;charset=utf-8
cbrc-20:transfer:moto=500
text/plain;charset=utf-8
cbrc-20:transfer:moto=500
text/plain;charset=utf-8
cbrc-20:transfer:moto=500
text/plain;charset=utf-8
cbrc-20:transfer:moto=500
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3351 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3367 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3360 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3352 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"213000000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"slor","amt":"25000"}h!
text/plain;charset=utf-8
-{"p":"sns","op":"reg","name":"degeNick.sats"}h!
text/plain;charset=utf-8
C{"p":"brc-20","op":"transfer","tick":"sbbs","amt":"31888888888888"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"Mirac","amt":"800000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"ordi","amt":"100"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"SoIa","amt":"21000000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"253666666666"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"SoIa","amt":"600000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"core","amt":"20000"}h!
text/plain;charset=utf-8
LU{"op":"minting-claim","p":"orc-20","params":{"amt":"1129.25","tick":"poi","tid":"1"}}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"SoIa","amt":"2000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"domo","amt":"6000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"6000"}h!
Lu<!DOCTYPE html><script 3313 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"MWCC","amt":"100000"}h!
Lu<!DOCTYPE html><script 3319 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3317 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":".com","amt":"360.77"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"ordi","amt":"2301.5"}h!
FjDOUT:BB6CEC2264FD6C1CC713BE7FBAAACD1B4920CEBCE01D040F522720B669B72E98
text/plain;charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"sats","amt":"209569640"}h!
FjDOUT:9CCCEBCD4E704FB67EF243B44DF6367F875CBF976D7A96670C4D952A218D4392
FjDOUT:2DA3C9F15C0682A8E635356F27FA1348F132326FC45613D633E60647BC60EB57
FjDOUT:6BCE0A556E5F2BF4586E630AF32ED00837067E3161F6E59D32DAFA01CAD9728A
FjDOUT:95214D3AC43DDC361C271ED9DD1BD7D03E39FA5609230ADEC727BA7281B215A6
FjDOUT:44B9F1743D41B5EE8B64D802212F30DFA3104CA615FC869F0C2FF427D41A2699
Bj@=:ETH.ETH:0x1ac4A0Ce17e9c4B036d669b30A8fE135bdbd7543:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0xEe422af895d0646ec5Eb4B2E443FAe61404Ffb62:0/1/0:ti:70
K/content/50c376da2ddaead36de2ab547057061e983c8fd798494af561226a4e9e5d0afbi0h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"PGID","amt":"4000"}h!
Lu<!DOCTYPE html><script 3285 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"XRGB","amt":"15000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"XRGB","amt":"25000"}h!
Lu<!DOCTYPE html><script 3349 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"Mirac","amt":"800000000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"131990"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"1000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"105980"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"102990"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"139990"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"Piin","amt":"10000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"108990"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"100"}h!
text/plain;charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"sats","amt":"180000000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"127990"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"118"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"3000000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"korm","amt":"55000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"mice","amt":"30000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"Piin","amt":"10000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"Piin","amt":"10000"}h!
33333333333333333333333333333333S
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"igem","amt":"500000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"110990"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"300"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"slor","amt":"20000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"AINN","amt":"96990"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"igem","amt":"1000000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"118900"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"112990"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"igem","amt":"500000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"AINN","amt":"99900"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"101990"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"AINN","amt":"112990"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"2000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"AINN","amt":"99900"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"AINN","amt":"99990"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"xcqr","amt":"75000"}h!
Ls<!DOCTYPE html><script 35 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
Bj@=:ETH.ETH:0xEf88a0Cf978F5dedc18517460478e5d5F25c9728:0/1/0:ti:70
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841635"}h!
Lu<!DOCTYPE html><script 3336 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"andy","amt":"1000"}h!
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3354 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3362 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
,j*0xb1Ef76e6A3890a996Eab788348644c1B8B3133Ba
,j*0x6eC5500Cb7AC4eFEdA9D0Aa902e5f33a651132ce
8{"p":"brc-20","op":"transfer","tick":"tstr","amt":"100"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"transfer","tick":"ordi","amt":"6"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"ORDG","amt":"7049"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"O4DX","amt":"12488"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"@LFG","amt":"10000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"cats","amt":"50000"}h!
:{"p":"brc-20","op":"mint","tick":"Piza","amt":"100000000"}h!
:{"p":"brc-20","op":"mint","tick":"Piza","amt":"100000000"}h!
:{"p":"brc-20","op":"mint","tick":"Piza","amt":"100000000"}h!
:{"p":"brc-20","op":"mint","tick":"Piza","amt":"100000000"}h!
:{"p":"brc-20","op":"mint","tick":"Piza","amt":"500000000"}h!
:{"p":"brc-20","op":"mint","tick":"Piza","amt":"100000000"}h!
Lu<!DOCTYPE html><script 3364 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Bj@=:BSC.BNB:0x4c358cdF47719cd4B62cEF1efdA3CE61ac6E29Dc:0/1/0:ti:70
Bj@=:ETH.ETH:0x92A2F14898e02605701838A9A128cB878182062D:0/1/0:ti:70
Lu<!DOCTYPE html><script 3323 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"ordi","amt":"0.2"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"ordi","amt":"0.2"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"ordi","amt":"0.2"}h!
Lu<!DOCTYPE html><script 3207 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3337 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
GjE=:ETH.USDT-EC7:0xDA9D13Cbb8977BbC9196A6f78b31F3821FBfC595:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0x267cCa17Bb9CF1929a32c263F994E78413B32dA8:0/1/0:ti:70
;[{"p":"brc-20","op":"transfer","tick":"cpos","amt":"1440"}]h!
F{"p":"tap","op":"token-transfer","tick":"DMT-NAT","amt":"16000000000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"sats","amt":"10988387"}h!
text/plain;charset=utf-8
Lu<!DOCTYPE html><script 3298 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3366 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3347 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3357 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3368 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3309 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3346 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"transfer","tick":"ORDG","amt":"2"}h!
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"ORDG","amt":"1310.57331948"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"ordi","amt":"0.2"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"ordi","amt":"0.2"}h!
Lu<!DOCTYPE html><script 3294 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3295 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
1&""&18/-/8D==DVQVpp
1&""&18/-/8D==DVQVpp
Ls<!DOCTYPE html><script 59 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
>{"p":"brc-20","op":"transfer","amt":"334091722","tick":"rats"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"ordi","amt":"150.29"}h!
text/plain;charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"sats","amt":"218209580"}h!
FjDOUT:9CAB4E6E4BFA8EAB0B25C2A94C2F788EC734A3DC2BF0CC467FE69D94345CCB66
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"trac","amt":"6000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"O4DX","amt":"1931.8"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"O4DX","amt":"1931.8"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"O4DX","amt":"965.5"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"O4DX","amt":"0.1"}h!
GjE=:ETH.USDT-EC7:0xEe422af895d0646ec5Eb4B2E443FAe61404Ffb62:0/1/0:ti:70
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"850000"}h!
-& &0-//----.-------//----/-------/-------------------
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"slor","amt":"10000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"piin","amt":"24000240"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"45000000000"}h!
Ls<!DOCTYPE html><script 70 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
GjE=:ETH.USDT-EC7:0x64BEDd35d439F654C546e2D652B556BB6a4e723d:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0xE8567de900B368baD7Ccb3380262202d5c10E934:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0xc45f61dE60a2973EEe672b31df4726d11355d7D0:0/1/0:ti:70
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"roup","amt":"650000"}h!
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"sats","amt":"3317051991.41"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"roup","amt":"700000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"slor","amt":"20000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"1000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"core","amt":"20000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"300"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"igem","amt":"430000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"roup","amt":"700000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"39000000000"}h!
text/plain;charset=utf-8
F{"p":"brc-20","op":"transfer","tick":"$
","amt":"1292084999999000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"4999"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"SATS","amt":"80981858.5184"}h!
dnamed#182jattributes
jtrait_typejBackgroundevaluemBackground 32
jtrait_typekWizard BodyevalueoPink Jelly Poop
jtrait_typedEyesevaluemScribble Eyes
jtrait_typeeMouthevaluehFat Lips
jtrait_typeiTippy TopevalueoBlue Wizard Hat
Lu<!DOCTYPE html><script 3259 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841636"}h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3373 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3381 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3343 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":1358,"minter":"bc1ptvp27wfjhqq2rzlfz8a5mwapacxs3k0juusuaw70dcltdvqxk6qszw9qxg","sig":"G+S6DXTSuoRews1v2Hb/PC3B01WDU91kODGuExS/QWnXbs2Hk9Onw0diiy+zuv+fSbCeBTA+Vwig6g5/jMoBytY="}hA
text/plain;charset=utf-8
D{"p":"brc-20","op":"transfer","tick":"sats","amt":"199935815147.62"}h!
Lu<!DOCTYPE html><script 3370 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3374 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
,j*0x2737b6a9bbf5c5710bb90b7f5accbe7cd78836a1
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
text/html;charset=utf-8
hburialIdxB57232b9155961e4724a4fca73d584fc2b38f52f1fe71ffa0c418f6d44bc5575bi0gboneyIdxB7a19e1f3088786c732c5f53b12904dae0063a8ac610ad3b8cec4a5ad991a8295i0dnamewroyal-turquoise-cariboupminingMultiplier
<!doctype html><html lang="en"><head><meta charset="utf-8"/><link href="/content/1a6e5dca0c78021028ce039409a0f2f40247798b433548e30afba1c498d6e030i0" rel="stylesheet"/><script src="/content/a9f6a9b050af3de1a4ce714978c1f2231ba731f1f46731a16d0e411f89308566i0"></script></head><body><script src="/content/58025710c2bcc8ff006859aa94254c18f5c424504386449522a666a99559ca6ei0" defer="defer"></script></body></html>h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3348 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
{"p":"BRC-100","op":"burn3","tick":"brc100","amt":"374","cop":"sw","to":"bos:lp_brc100_corgi","ext":{"aom":"169301591069.097880514088889266","dl":"1716360334"}}h!
Lu<!DOCTYPE html><script 3248 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3382 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"147167551197"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
{"p":"lam","op":"multi","calls":[{"contract":"dep:dmt:RAMBO","function":"mint","args":[]},{"contract":"dep:dmt:LAMBO","function":"mint","args":[]},{"contract":"dep:dmt:FIRST","function":"mint","args":[]},{"contract":"dep:dmt:LAMB","function":"mint","args":[]},{"contract":"dep:dmt:LAMBADA","function":"mint","args":[]},{"contract":"dep:dmt:SHAKES","function":"mint","args":[]},{"contract":"dep:dmt:GME","function":"mint","args":[]},{"contract":"dep:dmt:COCC","function":"mint","args":[]},{"contract":"dep:dmt:OXBT","func
tion":"mint","args":[]}]}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
hbitworkcd9420kmint_tickerdruneenonce
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3333 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3305 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3341 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3350 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3355 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3379 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3344 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3335 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3332 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3312 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"FSP ","amt":"9100000000000"}h!
Lu<!DOCTYPE html><script 3334 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
,j*0x993F97CD27d5970B1dc649873497223549b5F033
,j*0x5464a874e9c3B571d068ce0faAda9A12F4aE6482
o!2f/SBICrypto.com Pool/
text/plain;charset=utf-8
text/plain;charset=utf-8
G{"p":"brc-20","op":"transfer","tick":"sats","amt":"1633729314.6950116"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"sats","amt":"5635814.8832"}h!
text/plain;charset=utf-8
LR{"p":"brc-20","op":"deploy","tick":"Segd","lim":"100000000","max":"1000000000000"}h!
FjDOUT:5A85D775332F2BFFBCBE21C48CDAA1C24DB04490A45BFAB132F6233DC3651944
FjDOUT:B8BE3F147E31761594A2AFFE90315EFEB76717AFA6E2EFE72203135F96D9937C
FjDOUT:B6781569A75B58B3FC90678EBF9429F59B270D1466956296B15D80C16B6F7024
FjDOUT:0C28547407FD268706F9E7AC43DC1DC5EBCE5A03894F423FD35BB21A77ED86D0
FjDOUT:9E439D7ED5FFD5DBEB7C825FE2AD203CEF4F19B3F2910D468B77A7F566F83074
GjE=:ETH.USDT-EC7:0x6efAF87cf7eaA2751CD2b8A09c6441A9b21946F3:0/1/0:ti:70
,j*0x57a844a38fc3d3bca2d058e401584de9019b4939
Lu<!DOCTYPE html><script 3380 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3383 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
GjE=:ETH.USDT-EC7:0xcE8439B2E3f20CF1F5303BF9AE5062427ea4BDfa:0/1/0:ti:70
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":3301,"minter":"bc1pke077ssz3sdse5srfv9rh94ax9ulnmm2wkfe2g3u3kk2ng9cem5snz9z7j","sig":"HOYERyDL1dtmrnvIpmVEzNbB5uAxOZ14QE9b7EXD7jTZN383eDcku/MTwELY4jq2mPz8N+59DWQcZRrAfUNX5FY="}hA
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"
TC","amt":"24448"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"Mirac","amt":"800000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"piza","amt":"167"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"piza","amt":"531"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"AINN","amt":"1804.94"}h!
text/plain;charset=utf-8
D{"p":"brc-20","op":"transfer","tick":"$
","amt":"64400000000002"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"MTMT","amt":"1344000"}h!
text/plain;charset=utf-8
C{"p":"brc-20","op":"transfer","tick":"
","amt":"3333333333.666"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"PGID","amt":"2000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"AINN","amt":"2000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"satx","amt":"300000000000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"200000000000"}h!
text/plain;charset=utf-8
D{"p":"brc-20","op":"transfer","tick":"$
","amt":"78703636363636"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"44444444444"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"RYRY","amt":"8597950000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"MTMT","amt":"3500"}h!
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":1080,"minter":"bc1p5a0rv58z4k3y6edxfqe4g8mtn0zer0c048xqvnmh4als5qj2szhs8d40gq","sig":"G+Mku+qFGj49ZCzq2E/jUTu8DlUadhFkHgtwroTeLWaQIGkhsB1CcXGboqAx3SHE6uuB0ST+KZDDyWkhb6rovQ0="}hA
text/plain;charset=utf-8
D{"p":"brc-20","op":"transfer","tick":"piie","amt":"950000000000000"}h!
Lu<!DOCTYPE html><script 3361 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3376 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
C{"p":"brc-20","op":"transfer","tick":"MERMI","amt":"6666666666668"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"SoIa","amt":"14000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"300"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"SATS","amt":"80981858"}h!
text/plain;charset=utf-8
D{"p":"brc-20","op":"transfer","tick":"ANONO","amt":"58344292710000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"sats","amt":"200000000000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"183900472206"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"MTMT","amt":"350"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"5300"}h!
text/plain;charset=utf-8
D{"p":"brc-20","op":"transfer","tick":"ANONO","amt":"64826991900000"}h!
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841637"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"XBTCX","amt":"4200000000"}h!
Lu<!DOCTYPE html><script 3386 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
gGravityx4Gravity by Naka Liang, Genesis Abstract on Btc. 2024
;[{"p":"brc-20","op":"transfer","tick":"cpos","amt":"2160"}]h!
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
,j*0x7bBc82bdCfe32B1c2844D4361423c3ab51a5FBa7
,j*0xb32795B4a9732E7e9e89b277fff11Cde18c6E453
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
iCharacternJesus on chain
iCharacteriMona Lisa
fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffM
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
,j*0x592064e0468af50545e7b8e7f61a0bc24b45c3c4
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"PERQ","amt":"15000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
,j*0xc99bbe86127857e1898a9461c6620098eccf3338
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
text/plain;charset=utf-8
{"p":"lam","op":"multi","calls":[{"contract":"dep:dmt:RAMBO","function":"mint","args":[]},{"contract":"dep:dmt:LAMBO","function":"mint","args":[]},{"contract":"dep:dmt:FIRST","function":"mint","args":[]},{"contract":"dep:dmt:LAMB","function":"mint","args":[]},{"contract":"dep:dmt:LAMBADA","function":"mint","args":[]},{"contract":"dep:dmt:SHAKES","function":"mint","args":[]},{"contract":"dep:dmt:GME","function":"mint","args":[]},{"contract":"dep:dmt:COCC","function":"mint","args":[]},{"contract":"dep:dmt:OXBT","func
tion":"mint","args":[]}]}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"TX20","amt":"251"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"TX20","amt":"250"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"TX20","amt":"406"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"100"}h!
{"p":"tap","op":"dmt-deploy","elem":"def9719c203759a39d20d6392e714e3fe866e4efae73af9cd8bb846c73e8887di0","tick":"raremagenta","prj":"636a5c9d6b62b0fad86b2e0f42e4d74d9c1ad76d5df6392b9838d7c9475f09b5i0","dt":"h"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"TX20","amt":"404"}h!
text/plain;charset=utf-8
SjLP=:GAIA.ATOM:cosmos1ufahyv99tq4lpfgldhks072ag0pf70jgprctnr:107449519800/3/15:t:30wb
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"5696829.711"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"PUPS","amt":"200"}h!
FjDOUT:3E10E02CF2470DDA2DF514E7D38803CF54AB929FF6E42732C3D80E064FA39CAD
FjDOUT:C97441376D6AE4874BCB05100D4A0A8E62C3D35374CB6F516B82248615376FFA
FjDOUT:4250A2A8F3FD25F68CB5A40290CC715354A8D6B176D91F7C83DC220430D6F3AC
text/plain;charset=utf-8
{"p":"mrc-721","miner":{"name":"WKON","max":"5000","lim":"50"},"token":{"tick":"wkon","total":"2100000000000000","beg":"5000000000","halv":"20000","dcr":"0.5"},"burn":{"unit":"10000000000","boost":"0.01"}}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"sxio","amt":"6000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"PGID","amt":"1500"}h!
Bj@=:ETH.ETH:0x0d37B520eDfFC0Eda0C6B8b669767Cb2740057D4:0/1/0:ti:70
CjA=:ETH.USDT-EC7:0xf18B5D66e32a596673B1C237DE94919DB83f30e3:0:ti:70
GjE=:ETH.USDT-EC7:0x3bf2F96AADB07429D1a7a5E6Fa853FD431606721:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0x0cFe789FD0376C0259B3b0cF4d8B59348ba8Af3D:0/1/0:ti:70
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"VSAD","amt":"2500"}h!
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"300"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"slor","amt":"10000"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"1000000000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"110000000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"AMB ","amt":"1600000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"3822"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"ligo","amt":"1000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"core","amt":"3000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"1000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"igem","amt":"60000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"5000050"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"ordi","amt":"10.13"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"TRIO","amt":"50"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"deai","amt":"3887"}h!
text/plain;charset=utf-8
D{"p":"brc-20","op":"transfer","tick":"sats","amt":"5584108568.4304"}h!
GjE=:ETH.USDT-EC7:0xB196f34d71b9b607C0cd61549621f64D64097Fb8:0/1/0:ti:70
text/plain;charset=utf-8
text/plain;charset=utf-8
Lu<!DOCTYPE html><script 3372 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
""""""""""""""""""""""""""""""""S
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"67058806920"}h!
<svg width="800px" height="600px" xmlns="http://www.w3.org/2000/svg">
  <image href="/content/f5060e54930a9bb78e299130c1633a35ae28c43666b9c25272d27aca1bfda85ei0" width="100%" height="100%" />
  <image href="/content/2dffdfdab9fe907f185656a62ddf6b50026293e35429035d01a0dec5ea04d826i0" x="40%" y="10%" width="480px" height="480px" transform="translate(-50%, -50%)" webkit-transform="translate(-50%, -50%)" />
  <image href="/content/8c29c1552b4674427575e6fd55d0dcf34ac02dd2011319a12279993f59c4a727i0" x="30%" y="70%" wiLpdth="140px" height="140px" transform="translate(-50%, -50%)" webkit-transform="translate(-50%, -50%)" />
,j*0x33b55b16f29e1ad3ff769e7bc32f88718eae22de
text/html;charset=utf-8
<script data-s="0xaa481fe597803a7ebadf3c92b82c2a684a62797e82be288d30b29ab91e4295d0" src="/content/f80b93466a28c5efc703fab02beebbf4e32e1bc4f063ac27fedfd79ad982f2cei0"></script><body style="display: none"></body>
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841638"}h!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
Lu<!DOCTYPE html><script 3369 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"rats","amt":"1000000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"$DOG","amt":"55000000000"}h!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
Lu<!DOCTYPE html><script 3320 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3406 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3412 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3413 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3411 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3363 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"BSSB","amt":"254.57198458"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
jCorrectionhPordals
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DAII","amt":"9920"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
{"p":"lam","op":"multi","calls":[{"contract":"dep:dmt:RAMBO","function":"mint","args":[]},{"contract":"dep:dmt:LAMBO","function":"mint","args":[]},{"contract":"dep:dmt:FIRST","function":"mint","args":[]},{"contract":"dep:dmt:LAMB","function":"mint","args":[]},{"contract":"dep:dmt:LAMBADA","function":"mint","args":[]},{"contract":"dep:dmt:SHAKES","function":"mint","args":[]},{"contract":"dep:dmt:GME","function":"mint","args":[]},{"contract":"dep:dmt:COCC","function":"mint","args":[]},{"contract":"dep:dmt:OXBT","func
tion":"mint","args":[]}]}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"oadf","amt":"0.2"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
6{"p":"brc-20","op":"transfer","tick":"ordi","amt":"6"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
;{"p":"b137","op":"did-bind","tld":"b137","name":"ordinals"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
Lu<!DOCTYPE html><script 3395 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3359 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
L{{"p":"BRC-100","op":"mint3","tick":"corgi","amt":"241859415812.996972162984127523","cop":"w3","from":"bos:lp_brc100_corgi"}h!
Lu<!DOCTYPE html><script 3399 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"MERMI","amt":"222222222224"}h!
(2f/Foundry USA Pool #dropgold/f
text/plain;charset=utf-8
L[{"p":"brc-20","op":"deploy","tick":"alpha","max":"210000000","lim":"1000","self_mint":true}h!
Aj?=:THOR.RUNE:thor1fq30sqhq7x0whxdznrtrmj8fl6mjhzfqag7lgj::wr:100
IjGREFUND:8348B87E2E1537BA51669CA52F5ADA9BB32C311416547BAF34E7071A001D732B
FjDOUT:921F04DD576340CC57991F79EF67C9CE828E458D15BB7ADE9B1DD0737E3C239E
FjDOUT:E6234C78F09134015C34C4F13861CE2A060D40611270D1C5910D6A53E0F21538
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"sxio","amt":"2200"}h!
Bj@=:BSC.BNB:0x225950ff55D85e19bB6dEE26ed891A70fD13CDEC:0/1/0:ti:70
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":2134,"minter":"bc1p5gkyjmdk470re8y6r3yprnp758n8kzr5y3hfwm4rjmud0jj9qcpsthfa5m","sig":"HKV4Qjz/DladBb2GAmjlYt1Xr5zfpOHHwWr57km6TuBgdskdjiWjb8STlyFbykW1mlGMEPnHPBc4LdnQODmx0jU="}hA
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"SoIa","amt":"11000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"MTMT","amt":"105000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
C{"p":"brc-20","op":"transfer","tick":"MERMI","amt":"2519999999990"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"10000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"mint","tick":"Segd","amt":"100000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"slor","amt":"499"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"W
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"50000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"2000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"BTZF","amt":"7180000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"W
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1000000"}h!
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"mice","amt":"155475.774383"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"igem","amt":"480000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"Four","amt":"60000"}h!
33333333333333333333333333333333S
text/html;charset=utf-8
<script data-s="0x9832ca52fe8696bd81513417fb939d0dec107a8bad7f840e23f9d943c0e68b38" src="/content/f80b93466a28c5efc703fab02beebbf4e32e1bc4f063ac27fedfd79ad982f2cei0"></script><body style="display: none"></body>
Le<svg xmlns="http://www.w3.org/2000/svg" width="16" height="16" xmlns:v="https://vecta.io/nano"></svg>h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"core","amt":"10000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"4999"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"300"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"3000"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"Mirac","amt":"800000000"}h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841639"}h!
F{"p":"tap","op":"token-transfer","tick":"DMT-NAT","amt":"20000000000"}h!
Lu<!DOCTYPE html><script 3371 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3396 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3375 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
6j4=:ETH.ETH:0xC31BFf818Fb8060C65a543655DB8d4e09eF85a49
<svg width="800px" height="600px" xmlns="http://www.w3.org/2000/svg">
  <image href="/content/f5060e54930a9bb78e299130c1633a35ae28c43666b9c25272d27aca1bfda85ei0" width="100%" height="100%" transform="translate(-50%, -50%)" webkit-transform="translate(-50%, -50%)" />
  <image href="/content/2dffdfdab9fe907f185656a62ddf6b50026293e35429035d01a0dec5ea04d826i0" x="40%" y="10%" width="480px" height="480px" transform="translate(-50%, -50%)" webkit-transform="translate(-50%, -50%)" />
  <image href="/content/8c29c1552b4L
674427575e6fd55d0dcf34ac02dd2011319a12279993f59c4a727i0" x="30%" y="70%" width="140px" height="140px" transform="translate(-50%, -50%)" webkit-transform="translate(-50%, -50%)" />
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3388 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
,j*0x4c55849D3F413194d9644a3d3001360F287f5dB4
elatinvcanis lupus familiarisebreedgmaltesednamefphoebeegroupctoydtags
fgentlegplayfulhfearlesscnum
xiTXtXML:com.adobe.xmp
" id="W5M0MpCehiHzreSzNTczkc9d"?> <x:xmpmeta xmlns:x="adobe:ns:meta/" x:xmptk="Adobe XMP Core 9.1-c002 79.f354efc70, 2023/11/09-12:05:53        "> <rdf:RDF xmlns:rdf="http://www.w3.org/1999/02/22-rdf-syntax-ns#"> <rdf:Description rdf:about="" xmlns:xmpMM="http://ns.adobe.com/xap/1.0/mm/" xmlns:stRef="http://ns.adobe.com/xap/1.0/sType/ResourceRef#" xmlns:xmp="http://ns.adobe.com/xap/1.0/" xmpMM:OriM
ginalDocumentID="xmp.did:830c4cb3-7812-49c3-9497-4e4115a1d8dd" xmpMM:DocumentID="xmp.did:DF409430E04C11EEAF5AAE80F4911C69" xmpMM:InstanceID="xmp.iid:DF40942FE04C11EEAF5AAE80F4911C69" xmp:CreatorTool="Adobe Photoshop 25.5 (Macintosh)"> <xmpMM:DerivedFrom stRef:instanceID="xmp.iid:6fcb7010-ff80-471e-b7fe-d49d2af76029" stRef:documentID="xmp.did:830c4cb3-7812-49c3-9497-4e4115a1d8dd"/> </rdf:Description> </rdf:RDF> </x:xmpmeta> <?xpacket end="r"?>s
text/plain;charset=utf-8
D{"p":"brc-20","op":"transfer","tick":"$
","amt":"88888888888889"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"aisi","amt":"10000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"aisi","amt":"10000"}h!
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3378 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3398 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
D{"p":"brc-20","op":"transfer","tick":"$
","amt":"77777777777778"}h!
text/plain;charset=utf-8
{"p":"BRC-100","op":"burn3","tick":"brc100","amt":"365","cop":"al","to":"bos:lp_brc100_corgi","ts":[{"p":"brc-100","tick":"corgi","amt":"240543663468.132884012776749665"}],"ext":{"a0m":"255.5","a1m":"168380564427.693018808943724765","dl":"1716362532"}}h!
,j*0x6f8A83dd4f2bcE261D38F192BefA6e43428a3080
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
{"p":"lam","op":"multi","calls":[{"contract":"dep:dmt:RAMBO","function":"mint","args":[]},{"contract":"dep:dmt:LAMBO","function":"mint","args":[]},{"contract":"dep:dmt:FIRST","function":"mint","args":[]},{"contract":"dep:dmt:LAMB","function":"mint","args":[]},{"contract":"dep:dmt:LAMBADA","function":"mint","args":[]},{"contract":"dep:dmt:SHAKES","function":"mint","args":[]},{"contract":"dep:dmt:GME","function":"mint","args":[]},{"contract":"dep:dmt:COCC","function":"mint","args":[]},{"contract":"dep:dmt:OXBT","func
tion":"mint","args":[]}]}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
,j*0xf511906b953b8f8ac0f638a7cf7e390896b75de2
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
iCharacteriMona Lisa
iCharacteriMona Lisa
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"2000000000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
<{"p":"brc-20","op":"transfer","tick":"BSC ","amt":"5000000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"auto","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"b137","op":"did-bind","tld":"ink","name":"gaga"}h!
text/plain;charset=utf-8
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3316 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3393 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3385 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3286 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3377 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Powered by Luxor Tech
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"piza","amt":"506"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"63931185610"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"MMSS","amt":"3576.01054"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"MTMT","amt":"84000"}h!
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"MTMT","amt":"16800"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"MTMT","amt":"42000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"PUPS","amt":"10"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"core","amt":"6000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"MTMT","amt":"16800"}h!
Lu<!DOCTYPE html><script 3392 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3400 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841640"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"piza","amt":"500"}h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
iCCPsRGB IEC61966-2.1
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"TX20","amt":"408"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"trac","amt":"1000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"TX20","amt":"410"}h!
<svg xmlns="http://www.w3.org/2000/svg" viewBox="0 0 100 100">
        <image href="/content/581f4d05add77a0ca563830c36e4504281af6b27b10509ed793ec69d84b91b87i0" width="100%" height="100%"></image>
        <text text-anchor="middle" font-size="2" fill="black" y="66" x="50">e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855</text>
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
,j*0x89cca2416df6f0333c26f59798800a37c57f2ff5
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"TX20","amt":"402"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"RKGK","amt":"777"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"@LFG","amt":"9000"}h!
text/plain;charset=utf-8
{"p":"tap","op":"dmt-deploy","elem":"a1e7791a27360a19f15480668134338f9c5497af1fbadf465a85bdbd334d9755i0","tick":"rarewhite","prj":"636a5c9d6b62b0fad86b2e0f42e4d74d9c1ad76d5df6392b9838d7c9475f09b5i0","dt":"h"}h!
{"p":"tap","op":"dmt-deploy","elem":"f4cd72342dd2bc2d977afccdc68a7eff88c8d247ef0d6e40c7640675640e366ci0","tick":"raregray","prj":"636a5c9d6b62b0fad86b2e0f42e4d74d9c1ad76d5df6392b9838d7c9475f09b5i0","dt":"h"}h!
{"p":"tap","op":"dmt-deploy","elem":"4c6f89d2d93fc3b46d5807086b79c5a9409e73b374dbf31de8f8bea781dd1457i0","tick":"rarecyan","prj":"636a5c9d6b62b0fad86b2e0f42e4d74d9c1ad76d5df6392b9838d7c9475f09b5i0","dt":"h"}h!
<j:=:DOGE.DOGE:DG26UE1fvtyK1Yh5Pos9K78sEkPGFJ9uXW:0/1/0:td:70
Lu<!DOCTYPE html><script 3389 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3390 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3356 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Bj@=:ETH.ETH:0xd0DA1ccEcE1c205baC9F0af50c2dCF54a9895a84:0/1/0:td:70
Bj@=:ETH.ETH:0x970dDe38f52D637361384af8745A1aBFbeC54346:0/1/0:td:70
CjA=:LTC.LTC:ltc1qwc7laklswgehardktxhavhkcw8qsctyk0xye96:0/1/0:td:70
GjE=:ETH.USDT-EC7:0x86E4Ac16e3756e809fb18c8Fdae9DE6053f04d7c:0/1/0:ti:70
Lu<!DOCTYPE html><script 3409 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3410 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":401,"minter":"bc1pax22n0jydraeu9t6996a33ttujdsja39lw3wlmh70d202wu3xqesuz2au8","sig":"HMVxFeoLLi1e8KH1WJ69WLlQXzcVFUHznhuOogvPFiePccbC1KFgoTuNTy587lD9kpQCNXOkvkvPsP6ehnDBKEY="}hA
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"slor","amt":"29999"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"3000"}h!
FjD=:e:0xceb011316e019e67bb0e2e11902ec18466d7adad:2276244143/3/6:oky:30
FjDOUT:42EFF6D90F8C11AEDE5F639881A5A6246154813BC750122593D45C56A3BF1F76
FjDOUT:842E6E6C953513D80FCEE62D2EDC5E6DF8CD3E3D1C369FD9B4C8DF0AE74772F4
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"igem","amt":"240000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"110000000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"21700"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"Four","amt":"70000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"AINN","amt":"18000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"igem","amt":"120000"}h!
FjDOUT:353CCEC63A65F4EF6F3AB944EBC5D9CB16D92CB7CF0CCC13F22D72BF196DA635
,j*0x75fa2f1529a4a14b498e7d4922101d2a13da3b78
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"sats","amt":"1000000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"MTMT","amt":"4200"}h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841641"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"sxio","amt":"41200"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"DNCX","amt":"68000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"DNCX","amt":"50000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"tshx","amt":"15000"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"Mirac","amt":"800000000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"100000000000"}h!
text/plain;charset=utf-8
LU{"p":"brc-20","op":"deploy","tick":"ttms","max":"1200000000000","lim":"100000000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"300"}h!
text/plain;charset=utf-8
D{"p":"brc-20","op":"transfer","tick":"sats","amt":"1001111110.1111"}h!
GjE=:ETH.USDT-EC7:0x7f9308476a6486fF0F0c52Ac82a9D5837d03D1a7:0/1/0:ti:70
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"@LFG","amt":"20000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"TRIO","amt":"215.54"}h!
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3405 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"zbit","amt":"500"}h!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
,j*0xAD091229354420FCe427cf84de20884db20082d4
Lu<!DOCTYPE html><script 3428 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3429 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3417 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3423 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
,j*0x4ea881ebf45cee188d22a7e371623c50b0ee3a63
text/plain;charset=utf-8
{"p":"lam","op":"multi","calls":[{"contract":"dep:dmt:RAMBO","function":"mint","args":[]},{"contract":"dep:dmt:LAMBO","function":"mint","args":[]},{"contract":"dep:dmt:FIRST","function":"mint","args":[]},{"contract":"dep:dmt:LAMB","function":"mint","args":[]},{"contract":"dep:dmt:LAMBADA","function":"mint","args":[]},{"contract":"dep:dmt:SHAKES","function":"mint","args":[]},{"contract":"dep:dmt:GME","function":"mint","args":[]},{"contract":"dep:dmt:COCC","function":"mint","args":[]},{"contract":"dep:dmt:OXBT","func
tion":"mint","args":[]}]}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"aisi","amt":"10000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"119.81"}h!
<?xml version="1.0" encoding="UTF-8"?>
   xmlns:xsd="http://www.w3.org/2001/XMLSchema"
   targetNamespace="goods/1.1"
   elementFormDefault="qualified">
   <xsd:element name="deploy">
      <xsd:complexType>
         <xsd:sequence>
            <xsd:element name="name" type="xsd:string"/>
            <xsd:element name="id" type="xsd:string"/>
            <xsd:element name="addr" type="xsd:string"/>
            <xsd:element name="burn" type="xsd:string"/>
            <xsd:element name="url" type="xsd:striM
         </xsd:sequence>
     </xsd:complexType>
   <xsd:element name="product">
      <xsd:complexType>
         <xsd:sequence>
            <xsd:element name="dao" type="xsd:string"/>
            <xsd:element name="parent" type="xsd:string" minOccurs="0"/>
            <xsd:element name="name" type="xsd:string"/>
            <xsd:element name="desc" type="xsd:string"/>
            <xsd:element name="burn" type="xsd:boolean" minOccurs="0" default="true"/>
            <xsd:elemenM
t name="redeemable" type="xsd:boolean" minOccurs="0" default="true"/>
            <xsd:element name="weight" type="xsd:integer" minOccurs="0" default="1"/>
            <xsd:element name="url" type="xsd:string" minOccurs="0"/>
         </xsd:sequence>
     </xsd:complexType>
   <xsd:element name="subscription">
      <xsd:complexType>
         <xsd:sequence>
            <xsd:element name="num" type="xsd:integer"/>
            <xsd:element name="blk" type="xsd:integer"/>
            <xsd:element namM
e="blt" type="xsd:integer" minOccurs="0"/>
            <xsd:element name="lvl" type="xsd:integer" minOccurs="0" default="0"/>
            <xsd:element name="start" type="xsd:integer" minOccurs="0"/>
            <xsd:element name="term" type="xsd:integer" minOccurs="0"/>
            <xsd:element name="strict" type="xsd:boolean" minOccurs="0" default="false"/>
         </xsd:sequence>
     </xsd:complexType>
   <xsd:element name='item'>
      <xsd:complexType>
         <xsd:sequence>
d:element name="sub" type="xsd:string" minOccurs="0"/>
            <xsd:element name="num" type="xsd:integer" minOccurs="0" default="1"/>
            <xsd:element name="start" type="xsd:integer" minOccurs="0"/>
            <xsd:element name="term" type="xsd:integer" minOccurs="0"/>
         </xsd:sequence>
     </xsd:complexType>
   <xsd:element name='cert'>
      <xsd:complexType>
         <xsd:sequence>
            <xsd:element name="type" type="xsd:string" minOccurs="0"/>
            <xsd:elemeL
nt name="key" type="xsd:string" minOccurs="1"/>
            <xsd:element name="v" type="xsd:string" minOccurs="0"/>
         </xsd:sequence>
     </xsd:complexType>
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"aisi","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
9{"p":"b137","op":"did-bind","tld":"ink","name":"fayek11"}h!
text/plain;charset=utf-8
8{"p":"b137","op":"did-bind","tld":"ink","name":"haihai"}h!
:{"p":"brc-20","op":"mint","tick":"Nals","amt":"500000000"}h!
:{"p":"brc-20","op":"mint","tick":"Nals","amt":"500000000"}h!
:{"p":"brc-20","op":"mint","tick":"Nals","amt":"500000000"}h!
:{"p":"brc-20","op":"mint","tick":"Nals","amt":"500000000"}h!
:{"p":"brc-20","op":"mint","tick":"Nals","amt":"500000000"}h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3402 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
,j*0x43f50a3D02c9455587a1cb638085B34930E787Ca
,j*0x430c97a95D4A3F8d3639952f3c288786B56d7EA2
,j*0x57081322d3d19e6E63275573ea29EC5958B3742A
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
import * as fflate from '/content/f815bd5c566c6e46de5cdb6ccb3a7043c63deeba61f4234baea84b602b0d4440i0';
    const res = await fetch('/content/b9b7c11a16c87726aa375b9f34e32e0557c03d1d7f3bc3c6aea61bae6c744f1bi0');
    const compressed = new Uint8Array(await res.arrayBuffer());
    const inflated = await fflate.decompressSync(compressed);
    const model_viewer_string = new TextDecoder().decode(inflated);
    const model_viewer_new = model_viewer_string.
        replace('draco_decoder.wasm', '2799185f079M$
9cfaedc1313cabf27b56d2a37886e0effb6b3b98002742ebd0d54i0').
        replace('draco_wasm_wrapper.js', '16812aa49f537d4f335c64a8417866b53bb52110d48fa6c5393b2be1797e3cd6i0').
        replace('https://www.gstatic.com/draco/versioned/decoders/1.5.6/', '/content/');
    eval(model_viewer_new)
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
Powered by Luxor Tech
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"100000000000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"core","amt":"300000"}h!
Lu<!DOCTYPE html><script 3365 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
,j*0xa80c66584ab439b905bfae4e4b1b77b32d03bc50
Lu<!DOCTYPE html><script 3422 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3418 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3419 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3403 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/html;charset=utf-8
<script data-s="0x96f70fab394d3842aa2d2a2b26cf7a05a67749715d3dc24303e49f7589a4fc42" src="/content/f80b93466a28c5efc703fab02beebbf4e32e1bc4f063ac27fedfd79ad982f2cei0"></script><body style="display: none"></body>
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
F{"p":"brc-20","op":"transfer","tick":"sats","amt":"9135294.988160311"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
text/plain;charset=utf-8
4{"p":"brc-20","op":"mint","tick":"newb","amt":"512"}h!
Powered by Luxor Tech
Lu<!DOCTYPE html><script 3397 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"trac","amt":"539.7"}h!
&-/----+0----------//---.+-------------------------
-% &---0-+---0..--------.---/---.-----/---------------
text/plain;charset=utf-8
LM{"op":"burn","p":"orc-20","params":{"amt":"672472.5","tick":"poi","tid":"1"}}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"piza","amt":"4000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"piza","amt":"3000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"piin","amt":"12000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"MTMT","amt":"16800"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"MTMT","amt":"16800"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"slor","amt":"800"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"Mirac","amt":"800000000"}h!
Bj@=:ETH.ETH:0x0F4EF9cA7ea18c9f70EDBa4f6dcC5Ae2CEde682f:0/1/0:ti:70
text/plain;charset=utf-8
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"Four","amt":"50000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"43333333333"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"eorb","amt":"4000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"slor","amt":"800"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"cats","amt":"20000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"LEEK","amt":"211000000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"piza","amt":"2688"}h!
text/plain;charset=utf-8
{"p":"brc-420","op":"deploy","id":"8915ab35c5337da83de0754ef6f98cf6d660052b7c6dccbd6ab74cec43c6f395i0","name":"Mini Rune","max":"11500","price":"0.00023"}h!
text/plain;charset=utf-8
LU{"p":"brc-20","op":"deploy","tick":"ttms","max":"1200000000000","lim":"100000000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"Bear","amt":"2580"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"2100"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"850"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"5000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"BTZF","amt":"7180000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"bits","amt":"40000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"corn","amt":"2500"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"piin","amt":"485436"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"
","amt":"3700000000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"100000000000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"110000000000"}h!
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"rats","amt":"5000000.86769"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"sexy","amt":"128000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"100000000000"}h!
FjDOUT:42616C5E89256025A0D276806103A0ED3AEE0607E5ABFBCFB8739EA1A4FAF1C0
Lu<!DOCTYPE html><script 3416 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"tshx","amt":"2200"}h!
Lu<!DOCTYPE html><script 3391 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
  <meta charset="utf-8" />
  <script type="module" src="/content/547a6709441bc5c9d206150ce5fb7605c28a90c46bd6e4330c4420cb41477aeai0"></script>
      position: fixed;
<body style="background-color: #000000">
  <model-viewer src="/content/2c6c2cab96f272baabcc6f88b3705db5143b9ec583264969c8538cbf65c8d3aei0" auto-rotate="true" camera-controls="true" shadow-intensity="0" camera-target="0m 0.01Ljm 0m" camera-orbit="0deg 90deg 200m" ar-status="not-presenting" autoplay></model-viewer>
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"a436012d8d29f321d9a5625227dcb135e2679983bfbcfa2ed3e5f1faf242ef89","iid":"Rune Crystal","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":1062,"minter":"bc1pjncg63gsefna9mk8p0wfrdkd80sdccw4d9tsdc5gcetw7ktc896s90yks5","sig":"HBG+LvlDnLhbnNq9ZVJ8KQWQ+e7fAvZ22+Y9aXanegH2VtDmuGLox4mrAspbFRMvmLOfB4p0q1sPgaa/U2uDjqo="}hA
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841642"}h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841643"}h!
33333333333333333333333333333333S
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3404 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3439 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
,j*0x29f0bb5e866ae644920f753fd13176102c15dd5c
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
{"p":"lam","op":"multi","calls":[{"contract":"dep:dmt:RAMBO","function":"mint","args":[]},{"contract":"dep:dmt:LAMBO","function":"mint","args":[]},{"contract":"dep:dmt:FIRST","function":"mint","args":[]},{"contract":"dep:dmt:LAMB","function":"mint","args":[]},{"contract":"dep:dmt:LAMBADA","function":"mint","args":[]},{"contract":"dep:dmt:SHAKES","function":"mint","args":[]},{"contract":"dep:dmt:GME","function":"mint","args":[]},{"contract":"dep:dmt:COCC","function":"mint","args":[]},{"contract":"dep:dmt:OXBT","func
tion":"mint","args":[]}]}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
,j*0xd5261fa80d6a4d38cc83435b06af0b6414a0c17a
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"life","amt":"1000"}h!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3394 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3445 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
,j*0xfB824C36a2b501976bC91f959A15095243888888
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"10000000000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
Lu<!DOCTYPE html><script 3415 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Bj@=:ETH.ETH:0xd0DA1ccEcE1c205baC9F0af50c2dCF54a9895a84:0/1/0:td:70
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"ordi","amt":"494.2"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"ordi","amt":"1999.6"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"ordi","amt":"16218"}h!
Bj@=:BSC.BNB:0x40952a9046f1450346521EB05b1Bb38B692f8Cfa:0/1/0:ti:70
text/html;charset=utf-8
    <meta charset="UTF-8" />
    <meta name="viewport" content="width=device-width, initial-scale=1.0" />
    <title>diadepixales</title>
  <body style="margin: 0px">
      <img style="width:100%;margin:0px" src="/content/681b5373c03e3f819231afd9227f54101395299c9e58356bda278e2f32bef2cdi0" />
text/html;charset=utf-8
    <meta charset="UTF-8" />
    <meta name="viewport" content="width=device-width, initial-scale=1.0" />
    <title>diadepixales</title>
  <body style="margin: 0px">
      <img style="width:100%;margin:0px" src="/content/681b5373c03e3f819231afd9227f54101395299c9e58356bda278e2f32bef2cdi0" />
text/html;charset=utf-8
    <meta charset="UTF-8" />
    <meta name="viewport" content="width=device-width, initial-scale=1.0" />
    <title>diadepixales</title>
  <body style="margin: 0px">
      <img style="width:100%;margin:0px" src="/content/681b5373c03e3f819231afd9227f54101395299c9e58356bda278e2f32bef2cdi0" />
IjG=:ETH.USDC:0x95221D5F87636CC0122244d185C84fF8470d32b1:138648460800:t:30
FjDOUT:9F72F52A649C3C5A2A1CBC16F1B4BE32F83BDF44B960EA80EBF01D0E49651433
FjDOUT:3ECB4A74BBF423D94C10577017199E8B2FD7DC4D9BE2E4FE41DAC7C0D6D5B154
FjDOUT:B121206F890A44249D3018D08EAF64C3E66C86580FC47215AFD9AC13AE1A4AFF
FjDOUT:E33AE5E192BDE80E26F248D789651B0D188A612F9FD1AA71146DEE1F94C432F4
FjDOUT:B086AC6B3122170760C5E1C2B10408759FC93BBE1B68EB757287D5ACD29DCCC2
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"250"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
<j:=:DOGE.DOGE:DB5RiTTTLZvfqEtL99XtRAGZeP9ghsPFxA:0/1/0:ti:70
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"1000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"BTCs","amt":"500"}h!
text/html;charset=utf-8
<script data-s="0xc250f9a5a0451e6116ec5675bcd4c381909af512ba1044ee126aba110da00839" src="/content/f80b93466a28c5efc703fab02beebbf4e32e1bc4f063ac27fedfd79ad982f2cei0"></script><body style="display: none"></body>
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"igem","amt":"100000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"CPGT","amt":"4000"}h!
+------+-+-----+----+-++-8++-7+----7+-+---+-7+-+++
,j*0x79d5f0433663d3ec3bfadcf9c947b3f3351f45a8
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"1000000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"satx","amt":"200000000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"xDAO","amt":"2000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"PGID","amt":"1500"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"sxio","amt":"2000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"BTCs","amt":"105"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"PGID","amt":"3000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DAII","amt":"9920"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"79340150"}h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3424 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3401 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Bj@=:ETH.ETH:0xe31bC9C4c50D0Afc604B06fbB1fc76E44a4D2172:0/1/0:ti:70
Lu<!DOCTYPE html><script 3407 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3451 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
,j*0xb681b731501308201913B51989fCBBa00621308a
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"piin","amt":"12000120"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"MMSS","amt":"10000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"BETF","amt":"3000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"BMYX","amt":"45000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"PGID","amt":"1500"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"5006"}h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841644"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"zbit","amt":"1102"}h!
GjE=:BSC.USDT-955:0xcf74743cd48D76a416046B726871157034A2fdbe:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0xf8BB5962e57e34cc42C7789AbaAc7c96C12E62b9:0/1/0:ti:70
GjE=:ETH.USDC-B48:0x9417D18483c75155dcf2690Ea85166F13beFF852:0/1/0:ti:70
GjE=:ETH.USDT-EC7:0x83C01019605692749c59aB53d4682375CA35983a:0/1/0:ti:70
GjE=:BSC.USDT-955:0x4E935c3BAf16990ee5aCB05699106e0305Bc7f92:0/1/0:ti:70
GjE=:BSC.USDT-955:0x953407325a626Ac48fbe02E77D2c1036c23091fa:0/1/0:ti:70
Lu<!DOCTYPE html><script 3420 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"eorb","amt":"4000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"piin","amt":"20000000"}h!
,j*0xb4d3c118e0871b3467ca0ba4980b044e436f3111
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"110000000000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"piin","amt":"20000000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"
","amt":"110000000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"2000"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"piin","amt":"15000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"aisi","amt":"10000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"XQAI","amt":"1422222"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"piin","amt":"20000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"slor","amt":"16578"}h!
text/plain;charset=utf-8
?{"p":"brc-20","op":"transfer","tick":"mmwa","amt":"6000000000"}h!
text/html;charset=utf-8
<html lang="en"><title>Island Mist - Genify.XYZ</title><style>body{background:#000;margin:0;overflow: hidden;display:flex;justify-content:center;align-items:center;}</style><style id="gcss"></style><body><script>var tokenHash="0xf6b7fcce154881573dab6b8ef522cffe98ebaba3214b7fd05e9c4a97016cb5bc",tokenData={hash:tokenHash},hseed=1714565318</script><script src="/content/c9f2fc439b96b5ea98db5fd93e04ea84623fe6d210c06d40f90f027033696b43i0"></script><script src="/content/4101ee42de35bc37872be466b4801c36ed08088d6df05b0a7cb3L
f38f5e6bff3fi0"></script><div id="cw"></div><script src="/content/48bc9d562ca57e7d85b0fa873437654d9eca1b1dbd8d5c852823c2256faf748bi0"></script>h!
Lu<!DOCTYPE html><script 3436 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3421 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"piza","amt":"1633"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"transfer","tick":"piza","amt":"1"}h!
Lu<!DOCTYPE html><script 3384 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
,j*0x280c45F8CBdFb68D52b7D81231e4d831f5cACF16
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"zbit","amt":"1102"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"5800"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"4615000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"aisi","amt":"10000"}h!
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3414 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3460 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3430 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3452 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3459 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Mined by AntPool874!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"sats","amt":"17609435.154"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"ordi","amt":"2442"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"ordi","amt":"477.2"}h!
GjE=:ETH.USDT-EC7:0x4a48C3e2dAb5ec442269AAcaf2C64DD8C6863964:0/1/0:ti:70
FjDOUT:8FA36A37B543F5310C610F79A142ACCD28705915BFCFED66FF70097342DB1608
FjDOUT:0288D5F220E738A893D2A8EE60127D3F8D6322FE2E46D91DB3B285D03E851093
FjDOUT:9E3034BA3EBED6D3633E8022965CE3B65A855B873842BD1D23F313292B0BCDA7
FjDOUT:D28165BCD0F71B25539A0F1604BAE364EB4C9319C8D9CD26B8A7B2C432BBC0D0
Bj@=:ETH.ETH:0x83C01019605692749c59aB53d4682375CA35983a:0/1/0:ti:70
Lu<!DOCTYPE html><script 3482 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3491 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
GjE=:ETH.USDT-EC7:0x2cB69cFb3463732Be3d41d9405492bB704CF7D16:0/1/0:ti:70
GjE=:BSC.USDT-955:0x218aff5ECEd97EE3d814a1A7F871441Cf2d7Cb26:0/1/0:ti:70
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":345,"minter":"bc1pdxndnkjnf0uw4m5rnu6r69r2g5htgx9ahkspae5gu0gt8sqvcdeqrngsxf","sig":"HE+G+gZl23qMm4VZmeL+0cvIXivQg2HqYlQWYh5dZP/VJbSrd9hNiafNHT3mDXrDp3xeG8NBfIWm/ZTETzlPvEM="}hA
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"38888888888"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"piza","amt":"1000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"
","amt":"15000000000"}h!
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":522,"minter":"bc1p7p6qphkwhe0cqs5m23msekh0aq0twwqrd24357x7sx2aycc4v6asdjlgtz","sig":"G+K4/aTU7znrYFl6Jl8tuvwZ+CHwVXxoqNFA8nKhkU7wIOKkiWYUGH3uKOQPy4P/a0vNGXzxwEgitXVgsjyU9Cw="}hA
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":2323,"minter":"bc1p8yk8yze5av9cwx0xmwh7us5hzj4hvq4hlfqpz8dluryksc3xw4zs4hrw34","sig":"HIhkFx7x2p7tzLa7olLD/ycaZDuHeBprwlD+8DlKTgxRfJibp41Fwiqsg1ePzbzkfHOusTWTPGfk81fKp6uXRUk="}hA
Lu<!DOCTYPE html><script 3433 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"@LFG","amt":"13000"}h!
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"satx","amt":"1000000000006"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"DNCX","amt":"60000"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"satx","amt":"500000000000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"BTZF","amt":"7180000"}h!
Lu<!DOCTYPE html><script 3479 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
bidb46dnamelFaceless #46ftraits
eClasscEOSeRealmeMorosgElementfMatterdBasefPlasmagPower 1mQuantum MagicgPower 2uEthereal ManipulationiAbility 1hAffinityiAbility 2nShape Shiftingiimage_urlx_https://nftstorage.link/ipfs/bafybeie3ejrubvlmwr5tadzns4lioud4mh3eiak6twdrcw2xwnts4jwyqe/46.png
text/html;charset=utf-8
<script data-s="0x70498765cb99a8b3b917a5f22370a272e7baecd31659bfa976275f6bce29b00c" src="/content/f80b93466a28c5efc703fab02beebbf4e32e1bc4f063ac27fedfd79ad982f2cei0"></script><body style="display: none"></body>
8{"p":"brc-20","op":"transfer","tick":"tstr","amt":"100"}h!
Lu<!DOCTYPE html><script 3435 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3441 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":2330,"minter":"bc1p3g2xk866tclpd3ch6sd5fz987s9carzt3tqpumnau2h6ct4sx5ksazxt4v","sig":"GzTXPJPs/BesEjLZlqumLR2fQF1f5aMZx5LkwAv+dbaxDTtoHO9NVQV7eHngWV4ytgupovYOcgoF8ggNB4ishqM="}hA
,j*0x51c0c66b3c80edebf6b7e3db8b4eb8d1d1a0f8a5
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"5590"}h!
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":883,"minter":"bc1p07870ms55pl92leh8x6v2h2df6ny587j0z0uujzx6v3qr66dq7xszcpd9k","sig":"GzMg4L6Uvlfe0pLgF0zVqCAtLn/xtYLAP2/E/3lIGvFwQITQa1Qmni5MuR/CSLBgEj04KiWIHDfvKI2cxyimHwA="}hA
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":365,"minter":"bc1pj23syejqxgyhhg7xjs6d2fn2u8sdupjtyes7vhxcuwpp4ulmrxuq4hp5xm","sig":"HHr7U2El0tWdNo3U4r/xqcJPg6KoJLqrA5HEWOItON8SKaKfSaDwZcD+mvqEzIhIawzf5k6Rc7v/zwNBjIXMPus="}hA
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":"igem","amt":"346000"}h!
Lu<!DOCTYPE html><script 3456 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"500"}h!
Lu<!DOCTYPE html><script 3453 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3447 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"piza","amt":"1000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"NODE","amt":"4000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"sats","amt":"10000000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"NODE","amt":"4000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"core","amt":"30000"}h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841645"}h!
text/plain;charset=utf-8
PjLM=:ETH.USDT:0x303BFA6c2D3f20CB6AE278029f84B2B6a92E5E08:5619242087100/3/12:t:30E
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"rats","amt":"16408835"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"long","amt":"12740"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"NATO","amt":"21000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"NATO","amt":"21000"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"2000000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"ordi","amt":"73.2"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"4615000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"NATO","amt":"21000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"piza","amt":"2500"}h!
Le<svg xmlns="http://www.w3.org/2000/svg" width="16" height="16" xmlns:v="https://vecta.io/nano"></svg>h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"NATO","amt":"21000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"NATO","amt":"21000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"NATO","amt":"21000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"DeAI","amt":"4000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"NATO","amt":"21000"}h!
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":265,"minter":"bc1p2g2vpszjwkhf2my92lm4psdrpyeqzkn9e9fdp6walct2tn3s6essuwuk3j","sig":"HDk8QsocjzvFqJ6w57gldkCIF75Etr4j+l8NkKUkj7/IQHg+XEI3hER/++adLvWc71zr+cs0LetqOwTzY4Uo/5A="}hA
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":2598,"minter":"bc1pq3rmcjlkvytctp4v7j8g8r5nrhdttqez8vsa46wm3yxwecltegzqp20psl","sig":"HAC7X1naLO8lgajhiBYo2izvvFuw+xYbFcv1/HlTCK+mMKn293CW1gmOvgfkM2nzr6imTQ0PY6SlBQvWYc3IBH8="}hA
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"NATO","amt":"21000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"NATO","amt":"21000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"NATO","amt":"21000"}h!
Lu<!DOCTYPE html><script 3488 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3461 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3471 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3473 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3426 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3467 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3463 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3438 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
={"p":"brc-20","op":"mint","tick":"AIAQ","amt":"300000000000"}h!
text/plain;charset=utf-8
;{"p":"brc-20","op":"transfer","tick":".COM","amt":"114000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"beub","amt":"16000"}h!
text/plain;charset=utf-8
L{{"p":"BRC-100","op":"mint3","tick":"corgi","amt":"609153517474.664317406852622736","cop":"w3","from":"bos:lp_brc100_corgi"}h!
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3475 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
,j*0x64E2B16F876067884BAB37cfd855830c69e72b2B
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":38,"minter":"bc1p3g2xk866tclpd3ch6sd5fz987s9carzt3tqpumnau2h6ct4sx5ksazxt4v","sig":"G5vOYYt7OqAZl7wkwq3N9Gsz7pAM9UoR7D/vcvI1MZP/BhqoZB6h+xx05/c8qtVAKTv7c8frDdSHvP8LSDWTZT4="}hA
bidb45dnamelFaceless #45ftraits
eClasscEOSeRealmeMorosgElementfMatterdBasefPlasmagPower 1mQuantum MagicgPower 2uEthereal ManipulationiAbility 1hAffinityiAbility 2nShape Shiftingiimage_urlx_https://nftstorage.link/ipfs/bafybeie3ejrubvlmwr5tadzns4lioud4mh3eiak6twdrcw2xwnts4jwyqe/45.png
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":1729,"minter":"bc1pas6yrhq0u80mfh27gfgh4fw20khjz25lxnm4rhyfg60q62ayj2cstuq37q","sig":"HEksCGtMwSNCFhWDTEWHo10CkWJ0+rvZSHOZmW9DIdiVP6D6wlhjm/WIrPmhLtQrDXB2xll0hO1P2m7Mui5c8xE="}hA
Mined by AntPool830h
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841646"}h!
Lu<!DOCTYPE html><script 3476 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3477 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/html;charset=utf-8
Lt<!DOCTYPE html><script 663 src=/content/4a9166f097289baf38b73919cbbb869db29be6036a5c63305fa37546cf8ed5ebi0></script>h!
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":999,"minter":"bc1pzu4vwwxnrf87uygusns3vezse6xwj5ax94azkkf437q7xqd3uhkq3lhpra","sig":"Gy5F+s01QghCjIeiFe39DU5yixROTM6QpF7z8M0FeGXhTLB4PW5RgXfwMVIldpJmjCcOSSxZ+GrVgabIKcEPbJ8="}hA
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":2051,"minter":"bc1p2g2vpszjwkhf2my92lm4psdrpyeqzkn9e9fdp6walct2tn3s6essuwuk3j","sig":"G7gq5HSwo6RbvbJrzmV7Mo9/euIES/7PGa/HuqZbSFbCCquqQv2P6kze11eSU3/HFejkXqEFL1jI3P8IL238cr0="}hA
:{"p":"brc-20","op":"mint","tick":"Mubi","amt":"500000000"}h!
:{"p":"brc-20","op":"mint","tick":"Mubi","amt":"500000000"}h!
:{"p":"brc-20","op":"mint","tick":"Mubi","amt":"500000000"}h!
:{"p":"brc-20","op":"mint","tick":"Mubi","amt":"500000000"}h!
:{"p":"brc-20","op":"mint","tick":"Mubi","amt":"500000000"}h!
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3464 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3440 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
,j*0x3ece7fcc0ce7ac60788500fffdd7684fd9eb408d
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
:[{"p":"brc-20","op":"transfer","tick":"cpos","amt":"900"}]h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"6529","amt":"1000"}h!
;[{"p":"brc-20","op":"transfer","tick":"cpos","amt":"1080"}]h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":351,"minter":"bc1p7dym4thyapa9fnp3zcxt790hyqel5rgfhd9andspxkdc7z0zchkqt9awwg","sig":"HDBditsICDNV2WoOKdFqEJzbdZ6ieHe8qGSboXzw1a69X4V+K2hxNRWWGJ95cZOtOycqSglx/b6N0YdQXdaCoPE="}hA
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"UdiW","amt":"20000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":142,"minter":"bc1p7dym4thyapa9fnp3zcxt790hyqel5rgfhd9andspxkdc7z0zchkqt9awwg","sig":"GxFxN/w0ewoitu/4RLVbvcc2jTERd3z4vZbHuMC+Ht7XSeTg5F7SR7/VWhVWwxiySQUnmWtN8D/p10bbxT4+2ng="}hA
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"trac","amt":"1038"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/html;charset=utf-8
<html lang="en"><title>Island Mist - Genify.XYZ</title><style>body{background:#000;margin:0;overflow: hidden;display:flex;justify-content:center;align-items:center;}</style><style id="gcss"></style><body><script>var tokenHash="0xac88c930dd0d8c4c388a7d4cd3d21e7255cd31b7a5f5812e4d434ec346182ab8",tokenData={hash:tokenHash},hseed=1714565141</script><script src="/content/c9f2fc439b96b5ea98db5fd93e04ea84623fe6d210c06d40f90f027033696b43i0"></script><script src="/content/4101ee42de35bc37872be466b4801c36ed08088d6df05b0a7cb3L
f38f5e6bff3fi0"></script><div id="cw"></div><script src="/content/48bc9d562ca57e7d85b0fa873437654d9eca1b1dbd8d5c852823c2256faf748bi0"></script>h!
Lu<!DOCTYPE html><script 3465 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3432 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3408 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3483 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3448 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3450 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3434 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3427 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3468 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3437 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
33333333333333333333333333333333S
,j*0x847514efc7ea9963499867f27fecfb6d488cd001
,j*0x3B44144cc54dE2599306C8954b7c7E18e8498B10
text/plain;charset=utf-8
GjE=:ETH.USDT-EC7:0x16be8679d606F8f6064f1a494C217e4B6c06D9e9:0/1/0:ti:70
@j>=:l:ltc1qlu09xkht4hyjpr27wheuy730hf8we2td0x9emm:719516465:t:30
.-+--+-+-+--++-+++-+-+-++.---++-+-+-+---+---+0/+--
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3443 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"piza","amt":"1156"}h!
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"satx","amt":"100000000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"PGID","amt":"500"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"3000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"aisi","amt":"10000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"250"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"250"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"250"}h!
text/plain;charset=utf-8
={"p":"brc-20","op":"transfer","tick":"SoIa","amt":"14000000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"core","amt":"30000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"250"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"250"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"250"}h!
text/plain;charset=utf-8
<{"p":"brc-20","op":"transfer","tick":"piin","amt":"3000000"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"250"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"wzrd","amt":"250"}h!
=j;=:ETH.USDT:0xb93f507f014e986aecd49812b87340674f2b458c::t:30
GjE=:ETH.USDT-EC7:0x2cB69cFb3463732Be3d41d9405492bB704CF7D16:0/1/0:ti:70
text/plain;charset=utf-8
A{"p":"brc-20","op":"transfer","tick":"BSSB","amt":"254.57198458"}h!
Bj@=:ETH.ETH:0x0d115A5bbfdC9A9c06bE0E4106Fa128a11B20F3e:0/1/0:ti:70
,j*0xB4df40326055576b5da473144950dE1Da289024C
GjE=:ETH.USDT-EC7:0x60d0F24d97222726dD8355368cc4584500f31aE8:0/1/0:ti:70
Lu<!DOCTYPE html><script 3481 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3497 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841647"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"lend","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"mind","amt":"1000"}h!
text/plain;charset=utf-8
6{"p":"brc-20","op":"mint","tick":"what","amt":"10000"}h!
text/plain;charset=utf-8
:{"p":"b137","op":"did-bind","tld":"ink","name":"yuanwang"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
bidb43dnamelFaceless #43ftraits
eClasscEOSeRealmeMorosgElementfMatterdBasefPlasmagPower 1mQuantum MagicgPower 2uEthereal ManipulationiAbility 1hAffinityiAbility 2nShape Shiftingiimage_urlx_https://nftstorage.link/ipfs/bafybeie3ejrubvlmwr5tadzns4lioud4mh3eiak6twdrcw2xwnts4jwyqe/43.png
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
Le<svg xmlns="http://www.w3.org/2000/svg" width="16" height="16" xmlns:v="https://vecta.io/nano"></svg>h!
bidb39dnamelFaceless #39ftraits
eClasscEOSeRealmeMorosgElementfMatterdBasefPlasmagPower 1gSorcerygPower 2oCosmic PsionicsiAbility 1oReality WarpingiAbility 2nShape Shiftingiimage_urlx_https://nftstorage.link/ipfs/bafybeie3ejrubvlmwr5tadzns4lioud4mh3eiak6twdrcw2xwnts4jwyqe/39.png
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
bidb42dnamelFaceless #42ftraits
eClasscEOSeRealmeMorosgElementfMatterdBasefPlasmagPower 1mQuantum MagicgPower 2uEthereal ManipulationiAbility 1hAffinityiAbility 2nShape Shiftingiimage_urlx_https://nftstorage.link/ipfs/bafybeie3ejrubvlmwr5tadzns4lioud4mh3eiak6twdrcw2xwnts4jwyqe/42.png
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
text/plain;charset=utf-8
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
bidb44dnamelFaceless #44ftraits
eClasscEOSeRealmeMorosgElementfMatterdBasefPlasmagPower 1mQuantum MagicgPower 2uEthereal ManipulationiAbility 1hAffinityiAbility 2nShape Shiftingiimage_urlx_https://nftstorage.link/ipfs/bafybeie3ejrubvlmwr5tadzns4lioud4mh3eiak6twdrcw2xwnts4jwyqe/44.png
text/plain;charset=utf-8
text/plain;charset=utf-8
bidb41dnamelFaceless #41ftraits
eClasscEOSeRealmeMorosgElementfMatterdBasefPlasmagPower 1gSorcerygPower 2oCosmic PsionicsiAbility 1oReality WarpingiAbility 2nShape Shiftingiimage_urlx_https://nftstorage.link/ipfs/bafybeie3ejrubvlmwr5tadzns4lioud4mh3eiak6twdrcw2xwnts4jwyqe/41.png
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
,j*0x3fe04BE057E092b08d2d96e7070ba6e72F6FD81a
text/html;charset=utf-8
<html lang="en"><title>Island Mist - Genify.XYZ</title><style>body{background:#000;margin:0;overflow: hidden;display:flex;justify-content:center;align-items:center;}</style><style id="gcss"></style><body><script>var tokenHash="0x0a7503cd15e0438c819781350528c2e521728a9bcebf2ceb9b3a11594a9d1b31",tokenData={hash:tokenHash},hseed=1714565267</script><script src="/content/c9f2fc439b96b5ea98db5fd93e04ea84623fe6d210c06d40f90f027033696b43i0"></script><script src="/content/4101ee42de35bc37872be466b4801c36ed08088d6df05b0a7cb3L
f38f5e6bff3fi0"></script><div id="cw"></div><script src="/content/48bc9d562ca57e7d85b0fa873437654d9eca1b1dbd8d5c852823c2256faf748bi0"></script>h!
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
Lu<!DOCTYPE html><script 3425 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
33333333333333333333333333333333S
33333333333333333333333333333333S
33333333333333333333333333333333S
Lu<!DOCTYPE html><script 3454 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3455 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3484 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3442 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3449 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Bj@=:ETH.ETH:0x970dDe38f52D637361384af8745A1aBFbeC54346:0/1/0:td:70
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
bidb47dnamelFaceless #47ftraits
eClasscEOSeRealmeMorosgElementfMatterdBasefPlasmagPower 1mQuantum MagicgPower 2uEthereal ManipulationiAbility 1hAffinityiAbility 2nShape Shiftingiimage_urlx_https://nftstorage.link/ipfs/bafybeie3ejrubvlmwr5tadzns4lioud4mh3eiak6twdrcw2xwnts4jwyqe/47.png
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"PUPS","amt":"50"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
{"p":"tap","op":"dmt-deploy","elem":"fab3bbdcbc93d9df2881f7e9c78b1d382faf0b20b1430039a95edbbd5b1d46c7i0","tick":"rareblue","prj":"636a5c9d6b62b0fad86b2e0f42e4d74d9c1ad76d5df6392b9838d7c9475f09b5i0","dt":"h"}h!
{"p":"tap","op":"dmt-deploy","elem":"a4003fb21c3e2b0da1bb71f21c511399061d6fcdeac8dca401708fd47b91f01ei0","tick":"bitcoinlogo","prj":"636a5c9d6b62b0fad86b2e0f42e4d74d9c1ad76d5df6392b9838d7c9475f09b5i0","dt":"h"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
{"p":"lam","op":"multi","calls":[{"contract":"dep:dmt:RAMBO","function":"mint","args":[]},{"contract":"dep:dmt:LAMBO","function":"mint","args":[]},{"contract":"dep:dmt:FIRST","function":"mint","args":[]},{"contract":"dep:dmt:LAMB","function":"mint","args":[]},{"contract":"dep:dmt:LAMBADA","function":"mint","args":[]},{"contract":"dep:dmt:SHAKES","function":"mint","args":[]},{"contract":"dep:dmt:GME","function":"mint","args":[]},{"contract":"dep:dmt:COCC","function":"mint","args":[]},{"contract":"dep:dmt:OXBT","func
tion":"mint","args":[]}]}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
@{"p":"brc-20","op":"transfer","tick":"piin","amt":"1000888.888"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
LY{"p":"brc-20","op":"deploy","tick":"Larin","lim":"10000000","max":"0","self_mint":"true"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
LL{"p":"brc-20","op":"transfer","tick":"ornj","amt":"14025.24544179523141655"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"loan","amt":"1000"}h!
{"p":"tap","op":"dmt-deploy","elem":"32f06c8eb2e2737984fcef9b6260433bf08cebf9689a28c54c3653a2f9ebf595i0","tick":"burger","prj":"636a5c9d6b62b0fad86b2e0f42e4d74d9c1ad76d5df6392b9838d7c9475f09b5i0","dt":"n"}h!
{"p":"tap","op":"dmt-deploy","elem":"4bdbd4cb9ae636e1985f9cd006a2c9ba1318e5805fdda9433d5561ef57dd5dc0i0","tick":"zero21","prj":"636a5c9d6b62b0fad86b2e0f42e4d74d9c1ad76d5df6392b9838d7c9475f09b5i0","dt":"h"}h!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
hbitworkcd4342kmint_tickerncoloredbitcoinh!
{"p":"tap","op":"dmt-deploy","elem":"12f92057217b59151302c4805e84af74933f9e506200a42cd62acd517bc84a6ai0","tick":"starbucks","prj":"636a5c9d6b62b0fad86b2e0f42e4d74d9c1ad76d5df6392b9838d7c9475f09b5i0","dt":"n"}h!
,j*0x03474cC013DA37e0499F1b09d5649888fB4bE99a
:{"p":"brc-20","op":"mint","tick":"Ordi","amt":"500000000"}h!
:{"p":"brc-20","op":"mint","tick":"Ordi","amt":"500000000"}h!
:{"p":"brc-20","op":"mint","tick":"Ordi","amt":"500000000"}h!
:{"p":"brc-20","op":"mint","tick":"Ordi","amt":"500000000"}h!
:{"p":"brc-20","op":"mint","tick":"Ordi","amt":"500000000"}h!
Lu<!DOCTYPE html><script 3387 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3458 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3480 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3446 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
Lu<!DOCTYPE html><script 3487 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
=2f/SBICrypto.com Pool/
text/plain;charset=utf-8
B{"p":"brc-20","op":"transfer","tick":"sats","amt":"18397052.1972"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"transfer","tick":"ordi","amt":"10"}h!
text/plain;charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"sats","amt":"205000000"}h!
FjDOUT:F1E6C64D72568DC9B53BF86A2C44AFA1C572D064D0C6B7570DF3618674B694A5
FjDOUT:BC25B8D5488DD4E98D615159DCCDE2C7E5D1389EC161228F1FEBCAB9916DDC44
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"corn","amt":"1900"}h!
Bj@=:BSC.BNB:0x90E1884267eCf1A7041440aC25A3edc170302abc:0/1/0:ti:70
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"PGID","amt":"2999"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"FBTC","amt":"990"}h!
text/plain;charset=utf-8
8{"p":"brc-20","op":"transfer","tick":"slor","amt":"952"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"MMSS","amt":"10000"}h!
text/plain;charset=utf-8
:{"p":"brc-20","op":"transfer","tick":"slor","amt":"10000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"slor","amt":"1000"}h!
Bj@=:ETH.ETH:0xe31bC9C4c50D0Afc604B06fbB1fc76E44a4D2172:0/1/0:ti:70
bidb48dnamelFaceless #48ftraits
eClasscEOSeRealmeMorosgElementfMatterdBasefPlasmagPower 1mQuantum MagicgPower 2uEthereal ManipulationiAbility 1hAffinityiAbility 2nShape Shiftingiimage_urlx_https://nftstorage.link/ipfs/bafybeie3ejrubvlmwr5tadzns4lioud4mh3eiak6twdrcw2xwnts4jwyqe/48.png
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
{"p":"tap","op":"dmt-mint","dep":"4d967af36dcacd7e6199c39bda855d7b1b37268f4c8031fed5403a99ac57fe67i0","tick":"nat","blk":"841648"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/html;charset=utf-8
<iframe src="/content/fb162a46943e5d7d31d72ee2c8c850e66c1ca5d0d453068aa63883528285ed21i0?tokenID=1000" style="border:0" width=100% height=100%></iframe>
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"chef","amt":"1000"}h!
Lu<!DOCTYPE html><script 3498 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
""""""""""""""""""""""""""""""""S
            html, body { margin: 0; padding: 0; }
            img { width: 100%; height: 100%; object-fit: contain; image-rendering: pixelated;}
        <img src="/content/ba4ea0a061ee5f1612575c15728aec595c162351d3c4b3009e3e698f08fb16a1i0" />
Lu<!DOCTYPE html><script 3494 src=/content/bf7095a61e96900046e36c9fa147deedd285015eec05629ab78da9d138765c2fi0></script>h!
elatinvcanis lupus familiarisebreedjcane corsodnameechewyegroupgworkingdtags
kintelligenteloyaljprotectivecnum
xiTXtXML:com.adobe.xmp
" id="W5M0MpCehiHzreSzNTczkc9d"?> <x:xmpmeta xmlns:x="adobe:ns:meta/" x:xmptk="Adobe XMP Core 9.1-c002 79.dba3da3b5, 2023/12/15-10:42:37        "> <rdf:RDF xmlns:rdf="http://www.w3.org/1999/02/22-rdf-syntax-ns#"> <rdf:Description rdf:about="" xmlns:xmpMM="http://ns.adobe.com/xap/1.0/mm/" xmlns:stRef="http://ns.adobe.com/xap/1.0/sType/ResourceRef#" xmlns:xmp="http://ns.adobe.com/xap/1.0/" xmpMM:OriM
ginalDocumentID="xmp.did:7bdc5650-a5ec-439a-b348-97a251278cc6" xmpMM:DocumentID="xmp.did:4AB0D7CCFE3011EE80FDD41DC064F5AD" xmpMM:InstanceID="xmp.iid:4AB0D7CBFE3011EE80FDD41DC064F5AD" xmp:CreatorTool="Adobe Photoshop 25.7 (Macintosh)"> <xmpMM:DerivedFrom stRef:instanceID="xmp.iid:7bdc5650-a5ec-439a-b348-97a251278cc6" stRef:documentID="xmp.did:7bdc5650-a5ec-439a-b348-97a251278cc6"/> </rdf:Description> </rdf:RDF> </x:xmpmeta> <?xpacket end="r"?>
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
>{"p":"brc-20","op":"transfer","tick":"sats","amt":"500000000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
9{"p":"brc-20","op":"transfer","tick":"trac","amt":"1000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
text/plain;charset=utf-8
7{"p":"brc-20","op":"mint","tick":"near","amt":"100000"}h!
Bj@=:ETH.ETH:0xbD3e5261241d71ce547AB69904F31EBe5af38BaD:0/1/0:td:70
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":2589,"minter":"bc1p4yq6lstq07mu2xsmnfpzu0ufm6gmtq5qm5f07xh8x7nfxh6erkescdk6cw","sig":"Gy1mJCeezX+ftaQPl3npc10uSBRaxX0KghO6anoHrnArZXOsfUYihMLBue3lo1oaNC7/uYwW8slzWxaFJ5zq7ZY="}hA
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":504,"minter":"bc1psn829k8es0sr4qpmecx2f3dcpl4gvas2q6ncdtra8dx45mck4r0styfs65","sig":"HCGWhLqFNSrdYOsOZ3F7fvFKwj8NhdYoZ/OwqDkCuj0XIh54yuxIQgTIw4c8ulQZv3I8FBufT3eUFsbxMlNbS7k="}hA
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":928,"minter":"bc1plsn0q2yaa25ey52g8lstka63tewe9zqzkxju6v6yt6ed5fwfuu2shyjr47","sig":"HA4mzQsvyFBShjgqL0YfUE9CPyUnhv6reSCv2M+QpyMXedKJOPyxN3S4imVGKRO/k/xclJKm7+9m7+GpIGtsbMY="}hA
application/json;charset=utf-8
{"p":"vord","v":1,"ty":"insc","col":"f605dd6b41c8f3ef64c1e081d7e95aecde9e2250163799387a18d1e6e60c170f","iid":"Mfers of Bitcoin","publ":"1ES7b3pcjRzFgyiiqLrxHKTnChe56LJHY7","nonce":921,"minter":"bc1p7dym4thyapa9fnp3zcxt790hyqel5rgfhd9andspxkdc7z0zchkqt9awwg","sig":"GwS1R3jaknZn7+4OrNOvFLeAvoUK5EqK6y48g5UZo9L8fCab/kyI0rhHIQ7QbTpllixY9WFfJCKemb01vWqW9uc="}hA
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
33333333333333333333333333333333S
""""""""""""""""""""""""""""""""S
""""""""""""""""""""""""""""""""S
33333333333333333333333333333333S
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"dash","amt":"2500"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"dash","amt":"2500"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"dash","amt":"2500"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
{"p":"lam","op":"multi","calls":[{"contract":"dep:dmt:RAMBO","function":"mint","args":[]},{"contract":"dep:dmt:LAMBO","function":"mint","args":[]},{"contract":"dep:dmt:FIRST","function":"mint","args":[]},{"contract":"dep:dmt:LAMB","function":"mint","args":[]},{"contract":"dep:dmt:LAMBADA","function":"mint","args":[]},{"contract":"dep:dmt:SHAKES","function":"mint","args":[]},{"contract":"dep:dmt:GME","function":"mint","args":[]},{"contract":"dep:dmt:COCC","function":"mint","args":[]},{"contract":"dep:dmt:OXBT","func
tion":"mint","args":[]}]}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"dash","amt":"2500"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"dash","amt":"2500"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"dash","amt":"2500"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"dash","amt":"2500"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"Suno","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"hive","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000"}h!
text/plain;charset=utf-8
5{"p":"brc-20","op":"mint","tick":"casa","amt":"1000&